BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20084 (662 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY122257-1|AAM52769.1| 1608|Drosophila melanogaster SD08305p pro... 33 0.35 AF324426-1|AAG48328.1| 2531|Drosophila melanogaster transcriptio... 33 0.35 AE014296-3230|AAF49103.2| 2531|Drosophila melanogaster CG8491-PA... 33 0.35 AY069282-1|AAL39427.1| 433|Drosophila melanogaster GM13868p pro... 29 7.5 AM294339-1|CAL26269.1| 433|Drosophila melanogaster CG3831 protein. 29 7.5 AM294338-1|CAL26268.1| 433|Drosophila melanogaster CG3831 protein. 29 7.5 AM294337-1|CAL26267.1| 433|Drosophila melanogaster CG3831 protein. 29 7.5 AM294336-1|CAL26266.1| 433|Drosophila melanogaster CG3831 protein. 29 7.5 AM294335-1|CAL26265.1| 433|Drosophila melanogaster CG3831 protein. 29 7.5 AM294334-1|CAL26264.1| 433|Drosophila melanogaster CG3831 protein. 29 7.5 AM294333-1|CAL26263.1| 433|Drosophila melanogaster CG3831 protein. 29 7.5 AM294332-1|CAL26262.1| 433|Drosophila melanogaster CG3831 protein. 29 7.5 AM294331-1|CAL26261.1| 433|Drosophila melanogaster CG3831 protein. 29 7.5 AE013599-3515|AAF46934.2| 433|Drosophila melanogaster CG3831-PA... 29 7.5 >AY122257-1|AAM52769.1| 1608|Drosophila melanogaster SD08305p protein. Length = 1608 Score = 33.1 bits (72), Expect = 0.35 Identities = 15/47 (31%), Positives = 25/47 (53%) Frame = +1 Query: 61 IRQSFIGGYYSLVDENLKPLPDWWISVLYKKLVGNKVLQVQCNCSRF 201 +R S +GG + + +N P DW ++L +LV V+ + CN F Sbjct: 724 LRFSLVGGMFEAIQKNSTPTTDW--AILLAQLVCQGVVDLSCNRELF 768 >AF324426-1|AAG48328.1| 2531|Drosophila melanogaster transcriptional coactivator kohtaloprotein. Length = 2531 Score = 33.1 bits (72), Expect = 0.35 Identities = 15/47 (31%), Positives = 25/47 (53%) Frame = +1 Query: 61 IRQSFIGGYYSLVDENLKPLPDWWISVLYKKLVGNKVLQVQCNCSRF 201 +R S +GG + + +N P DW ++L +LV V+ + CN F Sbjct: 1687 LRFSLVGGMFEAIQKNSTPTTDW--AILLAQLVCQGVVDLSCNRELF 1731 >AE014296-3230|AAF49103.2| 2531|Drosophila melanogaster CG8491-PA protein. Length = 2531 Score = 33.1 bits (72), Expect = 0.35 Identities = 15/47 (31%), Positives = 25/47 (53%) Frame = +1 Query: 61 IRQSFIGGYYSLVDENLKPLPDWWISVLYKKLVGNKVLQVQCNCSRF 201 +R S +GG + + +N P DW ++L +LV V+ + CN F Sbjct: 1687 LRFSLVGGMFEAIQKNSTPTTDW--AILLAQLVCQGVVDLSCNRELF 1731 >AY069282-1|AAL39427.1| 433|Drosophila melanogaster GM13868p protein. Length = 433 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = +1 Query: 415 IMNLIYTICGLIFIGMDAMFHYLHILL 495 +MNL Y GL+++ D FHY + L Sbjct: 301 VMNLAYAFAGLVYLFKDFDFHYCALKL 327 >AM294339-1|CAL26269.1| 433|Drosophila melanogaster CG3831 protein. Length = 433 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = +1 Query: 415 IMNLIYTICGLIFIGMDAMFHYLHILL 495 +MNL Y GL+++ D FHY + L Sbjct: 301 VMNLAYAFAGLVYLFKDFDFHYCALKL 327 >AM294338-1|CAL26268.1| 433|Drosophila melanogaster CG3831 protein. Length = 433 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = +1 Query: 415 IMNLIYTICGLIFIGMDAMFHYLHILL 495 +MNL Y GL+++ D FHY + L Sbjct: 301 VMNLAYAFAGLVYLFKDFDFHYCALKL 327 >AM294337-1|CAL26267.1| 433|Drosophila melanogaster CG3831 protein. Length = 433 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = +1 Query: 415 IMNLIYTICGLIFIGMDAMFHYLHILL 495 +MNL Y GL+++ D FHY + L Sbjct: 301 VMNLAYAFAGLVYLFKDFDFHYCALKL 327 >AM294336-1|CAL26266.1| 433|Drosophila melanogaster CG3831 protein. Length = 433 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = +1 Query: 415 IMNLIYTICGLIFIGMDAMFHYLHILL 495 +MNL Y GL+++ D FHY + L Sbjct: 301 VMNLAYAFAGLVYLFKDFDFHYCALKL 327 >AM294335-1|CAL26265.1| 433|Drosophila melanogaster CG3831 protein. Length = 433 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = +1 Query: 415 IMNLIYTICGLIFIGMDAMFHYLHILL 495 +MNL Y GL+++ D FHY + L Sbjct: 301 VMNLAYAFAGLVYLFKDFDFHYCALKL 327 >AM294334-1|CAL26264.1| 433|Drosophila melanogaster CG3831 protein. Length = 433 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = +1 Query: 415 IMNLIYTICGLIFIGMDAMFHYLHILL 495 +MNL Y GL+++ D FHY + L Sbjct: 301 VMNLAYAFAGLVYLFKDFDFHYCALKL 327 >AM294333-1|CAL26263.1| 433|Drosophila melanogaster CG3831 protein. Length = 433 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = +1 Query: 415 IMNLIYTICGLIFIGMDAMFHYLHILL 495 +MNL Y GL+++ D FHY + L Sbjct: 301 VMNLAYAFAGLVYLFKDFDFHYCALKL 327 >AM294332-1|CAL26262.1| 433|Drosophila melanogaster CG3831 protein. Length = 433 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = +1 Query: 415 IMNLIYTICGLIFIGMDAMFHYLHILL 495 +MNL Y GL+++ D FHY + L Sbjct: 301 VMNLAYAFAGLVYLFKDFDFHYCALKL 327 >AM294331-1|CAL26261.1| 433|Drosophila melanogaster CG3831 protein. Length = 433 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = +1 Query: 415 IMNLIYTICGLIFIGMDAMFHYLHILL 495 +MNL Y GL+++ D FHY + L Sbjct: 301 VMNLAYAFAGLVYLFKDFDFHYCALKL 327 >AE013599-3515|AAF46934.2| 433|Drosophila melanogaster CG3831-PA protein. Length = 433 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = +1 Query: 415 IMNLIYTICGLIFIGMDAMFHYLHILL 495 +MNL Y GL+++ D FHY + L Sbjct: 301 VMNLAYAFAGLVYLFKDFDFHYCALKL 327 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 30,329,271 Number of Sequences: 53049 Number of extensions: 633516 Number of successful extensions: 1231 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 1182 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1231 length of database: 24,988,368 effective HSP length: 82 effective length of database: 20,638,350 effective search space used: 2848092300 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -