BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20080 (709 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_01_0382 - 5076673-5077774,5078122-5078186 29 2.7 02_04_0398 - 22598895-22599100,22599865-22599943 28 8.4 >04_01_0382 - 5076673-5077774,5078122-5078186 Length = 388 Score = 29.5 bits (63), Expect = 2.7 Identities = 14/30 (46%), Positives = 18/30 (60%) Frame = -1 Query: 130 DIAVVLFRSCVTIPGIFLKIYTFTIVLNKC 41 D+A+ LF T GI +TFT+VLN C Sbjct: 132 DVALQLFEEMKTKYGIAPTAHTFTLVLNAC 161 >02_04_0398 - 22598895-22599100,22599865-22599943 Length = 94 Score = 27.9 bits (59), Expect = 8.4 Identities = 11/21 (52%), Positives = 12/21 (57%), Gaps = 1/21 (4%) Frame = +3 Query: 273 GGSRESGCCSYVIHW-ECLSC 332 GG GCC + HW ECL C Sbjct: 73 GGHCRWGCCGHRNHWGECLRC 93 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,412,161 Number of Sequences: 37544 Number of extensions: 305437 Number of successful extensions: 578 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 567 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 577 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1827423340 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -