Bombyx BLAST Result against mosquito

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20080
         (709 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY745215-1|AAU93482.1|   56|Anopheles gambiae cytochrome P450 pr...    23   9.4  
AF510719-1|AAP47148.1|  591|Anopheles gambiae ammonium transport...    23   9.4  

>AY745215-1|AAU93482.1|   56|Anopheles gambiae cytochrome P450
           protein.
          Length = 56

 Score = 23.0 bits (47), Expect = 9.4
 Identities = 7/33 (21%), Positives = 18/33 (54%)
 Frame = +2

Query: 71  YFKKYSRNCHTRPKQHNRYIYCIKLNKNISTDM 169
           + ++YS + +   K +     C+ + +N+S D+
Sbjct: 1   HLERYSESIYRLTKDYEHETNCVNIIRNMSLDL 33


>AF510719-1|AAP47148.1|  591|Anopheles gambiae ammonium
           transport-like protein protein.
          Length = 591

 Score = 23.0 bits (47), Expect = 9.4
 Identities = 7/9 (77%), Positives = 8/9 (88%)
 Frame = +2

Query: 464 CIFLFVLWW 490
           C+ LFVLWW
Sbjct: 238 CMGLFVLWW 246


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 701,021
Number of Sequences: 2352
Number of extensions: 14370
Number of successful extensions: 41
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 41
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 41
length of database: 563,979
effective HSP length: 62
effective length of database: 418,155
effective search space used: 72340815
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)