BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20074 (622 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC576.06c |||tyrosine-tRNA ligase|Schizosaccharomyces pombe|ch... 27 2.9 SPAC14C4.10c |||Nudix family hydrolase|Schizosaccharomyces pombe... 25 8.8 >SPCC576.06c |||tyrosine-tRNA ligase|Schizosaccharomyces pombe|chr 3|||Manual Length = 445 Score = 26.6 bits (56), Expect = 2.9 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = +2 Query: 392 LLCLSYASGRGLVHSTKVLQKCMTVASILI 481 L CL R L+H+T +LQ V S+ + Sbjct: 5 LACLKQLQARSLIHNTTLLQPSCNVNSVYL 34 >SPAC14C4.10c |||Nudix family hydrolase|Schizosaccharomyces pombe|chr 1|||Manual Length = 329 Score = 25.0 bits (52), Expect = 8.8 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = +3 Query: 348 QNFVKFNYTYTCLSVYYVYL 407 Q + + N+ +TCL+ YY YL Sbjct: 282 QVYPRGNWVFTCLNGYYPYL 301 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,276,507 Number of Sequences: 5004 Number of extensions: 42010 Number of successful extensions: 93 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 92 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 93 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 273658928 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -