BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20074 (622 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AE014298-2874|AAF48973.1| 1039|Drosophila melanogaster CG14217-P... 28 8.9 AE014298-2873|AAN09504.1| 1039|Drosophila melanogaster CG14217-P... 28 8.9 AB277547-1|BAF51959.1| 1039|Drosophila melanogaster serine/threo... 28 8.9 >AE014298-2874|AAF48973.1| 1039|Drosophila melanogaster CG14217-PE, isoform E protein. Length = 1039 Score = 28.3 bits (60), Expect = 8.9 Identities = 13/51 (25%), Positives = 23/51 (45%) Frame = +2 Query: 386 VSLLCLSYASGRGLVHSTKVLQKCMTVASILIVDKTVCVDVTCGQFNVPCP 538 ++ +CL SG +HS + + + +IL+ D V G + CP Sbjct: 127 IAAICLGVLSGLSYLHSLGRIHRDIKAGNILLTDNGVVKLADFGSAAIKCP 177 >AE014298-2873|AAN09504.1| 1039|Drosophila melanogaster CG14217-PD, isoform D protein. Length = 1039 Score = 28.3 bits (60), Expect = 8.9 Identities = 13/51 (25%), Positives = 23/51 (45%) Frame = +2 Query: 386 VSLLCLSYASGRGLVHSTKVLQKCMTVASILIVDKTVCVDVTCGQFNVPCP 538 ++ +CL SG +HS + + + +IL+ D V G + CP Sbjct: 127 IAAICLGVLSGLSYLHSLGRIHRDIKAGNILLTDNGVVKLADFGSAAIKCP 177 >AB277547-1|BAF51959.1| 1039|Drosophila melanogaster serine/threonine protein kinaseTAO1 alpha protein. Length = 1039 Score = 28.3 bits (60), Expect = 8.9 Identities = 13/51 (25%), Positives = 23/51 (45%) Frame = +2 Query: 386 VSLLCLSYASGRGLVHSTKVLQKCMTVASILIVDKTVCVDVTCGQFNVPCP 538 ++ +CL SG +HS + + + +IL+ D V G + CP Sbjct: 127 IAAICLGVLSGLSYLHSLGRIHRDIKAGNILLTDNGVVKLADFGSAAIKCP 177 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,295,252 Number of Sequences: 53049 Number of extensions: 445116 Number of successful extensions: 1032 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1006 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1032 length of database: 24,988,368 effective HSP length: 82 effective length of database: 20,638,350 effective search space used: 2559155400 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -