BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20072 (691 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_04_0213 + 20974712-20975413 31 0.86 05_01_0074 + 506803-507963 28 8.0 >02_04_0213 + 20974712-20975413 Length = 233 Score = 31.1 bits (67), Expect = 0.86 Identities = 16/56 (28%), Positives = 26/56 (46%) Frame = +3 Query: 324 ITKENEEKSIQTHLELSRQEKAAWEETKMYGWQDFQDFTLRRMFKKYSQLGVAALP 491 + +E EE+ + E R +A EE W+DF D L ++ ++ Q A P Sbjct: 73 VDEEEEEERMDQLWERDRDARAGDEERMDLLWEDFNDELLLQLRRRQQQRAAAGTP 128 >05_01_0074 + 506803-507963 Length = 386 Score = 27.9 bits (59), Expect = 8.0 Identities = 13/38 (34%), Positives = 18/38 (47%) Frame = -3 Query: 656 HVSTPQGLGSWRISQLSQAPKIDRIYSHSCTSRSSRWR 543 H S Q S +L+ A ++SH SRS+ WR Sbjct: 337 HSSNSQASSSHSRPELNDASDRSAVFSHGSRSRSTSWR 374 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,456,037 Number of Sequences: 37544 Number of extensions: 371474 Number of successful extensions: 1062 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1041 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1062 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1756684372 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -