BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20070 (639 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g49970.2 68418.m06187 pyridoxamine 5'-phosphate oxidase-relat... 93 1e-19 At5g49970.1 68418.m06188 pyridoxamine 5'-phosphate oxidase-relat... 93 1e-19 At3g26125.1 68416.m03258 cytochrome P450, putative 29 2.6 At1g50020.1 68414.m05613 expressed protein 29 2.6 At5g59590.1 68418.m07467 UDP-glucoronosyl/UDP-glucosyl transfera... 29 3.4 At1g13150.1 68414.m01525 cytochrome P450, putative strong simila... 29 3.4 At3g23890.1 68416.m03002 DNA topoisomerase, ATP-hydrolyzing / DN... 28 4.5 At1g13140.1 68414.m01523 cytochrome P450 family protein similar ... 28 6.0 >At5g49970.2 68418.m06187 pyridoxamine 5'-phosphate oxidase-related contains weak similarity to Pyridoxamine 5'-phosphate oxidase (EC 1.4.3.5) (PNP/PMP oxidase) (PNPOx). (Swiss-Prot:P28225) [Shigella flexneri] Length = 466 Score = 93.1 bits (221), Expect = 1e-19 Identities = 43/67 (64%), Positives = 52/67 (77%) Frame = +2 Query: 308 YLNQSEAAALDQDLFTEYKFSVDQLMELAGLSVASAIAKVFPPSTHSSALIVCGPGNNGG 487 YL Q EAA +D+ L FS+DQLMELAGLSVA++IA+V+ P +S L +CGPGNNGG Sbjct: 75 YLTQREAAEIDETLMGPLGFSIDQLMELAGLSVAASIAEVYKPEEYSRVLAICGPGNNGG 134 Query: 488 DGLVAAR 508 DGLVAAR Sbjct: 135 DGLVAAR 141 Score = 36.3 bits (80), Expect = 0.017 Identities = 18/40 (45%), Positives = 23/40 (57%), Gaps = 2/40 (5%) Frame = +1 Query: 520 FGYNVSVHYPKRTPKPLYENLLEQCIRFNVNI--IDKLPD 633 FGY + YPKRT KPLY L+ Q +V ++ LPD Sbjct: 146 FGYKPFICYPKRTAKPLYTGLVTQLDSLSVPFVSVEDLPD 185 >At5g49970.1 68418.m06188 pyridoxamine 5'-phosphate oxidase-related contains weak similarity to Pyridoxamine 5'-phosphate oxidase (EC 1.4.3.5) (PNP/PMP oxidase) (PNPOx). (Swiss-Prot:P28225) [Shigella flexneri] Length = 530 Score = 93.1 bits (221), Expect = 1e-19 Identities = 43/67 (64%), Positives = 52/67 (77%) Frame = +2 Query: 308 YLNQSEAAALDQDLFTEYKFSVDQLMELAGLSVASAIAKVFPPSTHSSALIVCGPGNNGG 487 YL Q EAA +D+ L FS+DQLMELAGLSVA++IA+V+ P +S L +CGPGNNGG Sbjct: 75 YLTQREAAEIDETLMGPLGFSIDQLMELAGLSVAASIAEVYKPEEYSRVLAICGPGNNGG 134 Query: 488 DGLVAAR 508 DGLVAAR Sbjct: 135 DGLVAAR 141 Score = 36.3 bits (80), Expect = 0.017 Identities = 18/40 (45%), Positives = 23/40 (57%), Gaps = 2/40 (5%) Frame = +1 Query: 520 FGYNVSVHYPKRTPKPLYENLLEQCIRFNVNI--IDKLPD 633 FGY + YPKRT KPLY L+ Q +V ++ LPD Sbjct: 146 FGYKPFICYPKRTAKPLYTGLVTQLDSLSVPFVSVEDLPD 185 >At3g26125.1 68416.m03258 cytochrome P450, putative Length = 541 Score = 29.1 bits (62), Expect = 2.6 Identities = 11/22 (50%), Positives = 16/22 (72%), Gaps = 1/22 (4%) Frame = +2 Query: 521 SDTMYRYIILNAHPNLCM-KTF 583 SD ++Y++ NA P LC+ KTF Sbjct: 464 SDDQFKYVVFNAGPRLCLGKTF 485 >At1g50020.1 68414.m05613 expressed protein Length = 209 Score = 29.1 bits (62), Expect = 2.6 Identities = 13/41 (31%), Positives = 22/41 (53%) Frame = -1 Query: 555 AFRIMYRYIVSEQLHILAATKPSPPLFPGPHTIRADE*VEG 433 AF +Y Y ++ +H + T SPP + P+ + DE + G Sbjct: 163 AFSALYLYFGADFIHDGSRTPVSPPPYIDPYALLEDERISG 203 >At5g59590.1 68418.m07467 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 449 Score = 28.7 bits (61), Expect = 3.4 Identities = 9/25 (36%), Positives = 16/25 (64%) Frame = +3 Query: 30 RIIHNNTYHTIKCIIYDTYLYR*HA 104 +++H + I C++YD Y+Y HA Sbjct: 98 QLLHEQCNNDIACVVYDEYMYFSHA 122 >At1g13150.1 68414.m01525 cytochrome P450, putative strong similarity to gi|3313615 F21J9.9 from Arabidopsis thaliana and is a member of the PF|00067 Cytochrome P450 family Length = 529 Score = 28.7 bits (61), Expect = 3.4 Identities = 11/22 (50%), Positives = 16/22 (72%), Gaps = 1/22 (4%) Frame = +2 Query: 521 SDTMYRYIILNAHPNLCM-KTF 583 SD ++Y++ NA P LC+ KTF Sbjct: 449 SDDQFKYVVFNAGPRLCIGKTF 470 >At3g23890.1 68416.m03002 DNA topoisomerase, ATP-hydrolyzing / DNA topoisomerase II / DNA gyrase (TOP2) identical to SP|P30182 DNA topoisomerase II (EC 5.99.1.3) {Arabidopsis thaliana} Length = 1473 Score = 28.3 bits (60), Expect = 4.5 Identities = 19/67 (28%), Positives = 34/67 (50%), Gaps = 1/67 (1%) Frame = -3 Query: 313 EVPRHSVALIHTARHSSDVISFATRN-IRALPNNLYNNI*EDSFTVFLLLIIDT*FGSKC 137 ++ H VA ++ +++V + +N + N L +N DS T L + + FGSKC Sbjct: 335 QITNHIVAAVNKKNKNANVKAHNVKNHLWVFVNALIDNPAFDSQTKETLTLRQSSFGSKC 394 Query: 136 QLK*YFI 116 +L F+ Sbjct: 395 ELSEDFL 401 >At1g13140.1 68414.m01523 cytochrome P450 family protein similar to Cytochrome P450 86A2 (SP:O23066) [Arabidopsis thaliana]; contains Pfam PF|00067 Cytochrome P450 family Length = 519 Score = 27.9 bits (59), Expect = 6.0 Identities = 10/22 (45%), Positives = 16/22 (72%), Gaps = 1/22 (4%) Frame = +2 Query: 521 SDTMYRYIILNAHPNLCM-KTF 583 +D ++Y++ NA P LC+ KTF Sbjct: 441 NDDQFKYVVFNAGPRLCLGKTF 462 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,143,382 Number of Sequences: 28952 Number of extensions: 264799 Number of successful extensions: 588 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 574 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 588 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1314848736 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -