BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20067 (619 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_05_0161 - 18757122-18757331,18757931-18758488 31 0.55 02_01_0232 + 1543597-1543800,1544189-1544377,1544695-1544859,154... 30 1.7 12_02_1075 - 25854662-25855015,25855895-25856045,25856141-258563... 29 3.0 11_01_0193 - 1534051-1534092,1536343-1537065 27 9.0 >01_05_0161 - 18757122-18757331,18757931-18758488 Length = 255 Score = 31.5 bits (68), Expect = 0.55 Identities = 14/29 (48%), Positives = 18/29 (62%) Frame = -1 Query: 118 LPGPCPHVVANSLTSVQPLNNGYT*FLES 32 LP P PHV++N + +Q L N YT L S Sbjct: 180 LPRPTPHVISNIIKIMQNLRNAYTLALPS 208 >02_01_0232 + 1543597-1543800,1544189-1544377,1544695-1544859, 1545199-1545459,1546059-1546271,1546365-1546587, 1547974-1548149 Length = 476 Score = 29.9 bits (64), Expect = 1.7 Identities = 12/25 (48%), Positives = 18/25 (72%) Frame = +3 Query: 270 LSQRLHMLCISGIQTSQVQLPRNRY 344 L QRL +LCI G+ T +++ R+RY Sbjct: 445 LMQRLTVLCIRGVSTYPIKIIRSRY 469 >12_02_1075 - 25854662-25855015,25855895-25856045,25856141-25856378, 25856494-25856704,25856973-25857088,25857844-25857877, 25857996-25858253 Length = 453 Score = 29.1 bits (62), Expect = 3.0 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = -3 Query: 602 EVTASYCSQTSQDEGSLGCCWIG*LRKG 519 + T ++CS +GS GC ++G LR G Sbjct: 115 KATKNFCSGHKLGQGSFGCVYLGKLRNG 142 >11_01_0193 - 1534051-1534092,1536343-1537065 Length = 254 Score = 27.5 bits (58), Expect = 9.0 Identities = 14/39 (35%), Positives = 21/39 (53%), Gaps = 1/39 (2%) Frame = +1 Query: 325 SFLEI-GTQKFGDDILDLVVENADPRYPINLDDFMFKKL 438 SFL+ Q+ DD +DLV+ DP + I D ++ L Sbjct: 118 SFLDCYARQQLFDDAVDLVLNQLDPLFGIQADTVVYNHL 156 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,942,355 Number of Sequences: 37544 Number of extensions: 319702 Number of successful extensions: 1043 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1000 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1043 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1490248872 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -