BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20065 (649 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 27 0.18 AY584475-1|AAS93634.1| 209|Tribolium castaneum homothorax protein. 22 3.8 AJ518941-1|CAD57735.1| 456|Tribolium castaneum homothorax protein. 22 3.8 DQ855490-1|ABH88177.1| 133|Tribolium castaneum chemosensory pro... 21 8.7 AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory recept... 21 8.7 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 26.6 bits (56), Expect = 0.18 Identities = 10/23 (43%), Positives = 16/23 (69%) Frame = +3 Query: 174 SEDFRQKIHGQVRSCVQTATRGS 242 +ED+RQ++H QV C+ + GS Sbjct: 87 AEDYRQEVHAQVYVCLAKNSVGS 109 >AY584475-1|AAS93634.1| 209|Tribolium castaneum homothorax protein. Length = 209 Score = 22.2 bits (45), Expect = 3.8 Identities = 7/15 (46%), Positives = 8/15 (53%) Frame = -2 Query: 276 LCPNLCSAYLVCFLG 232 LC N C Y+ C G Sbjct: 11 LCDNFCHRYISCLKG 25 >AJ518941-1|CAD57735.1| 456|Tribolium castaneum homothorax protein. Length = 456 Score = 22.2 bits (45), Expect = 3.8 Identities = 7/15 (46%), Positives = 8/15 (53%) Frame = -2 Query: 276 LCPNLCSAYLVCFLG 232 LC N C Y+ C G Sbjct: 167 LCDNFCHRYISCLKG 181 >DQ855490-1|ABH88177.1| 133|Tribolium castaneum chemosensory protein 4 protein. Length = 133 Score = 21.0 bits (42), Expect = 8.7 Identities = 8/32 (25%), Positives = 16/32 (50%) Frame = -3 Query: 443 HWKILQSIFFVQNNYKSSFQSHTSNEVKIVDS 348 +WK L++ + YK + +EV V++ Sbjct: 102 YWKALEAKYDPDGTYKKRYFESQKDEVSKVEA 133 >AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory receptor candidate 19 protein. Length = 355 Score = 21.0 bits (42), Expect = 8.7 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = -1 Query: 550 IRRIFYLSH*IITKNIFICFIL 485 +RRI+Y IT N+ + F+L Sbjct: 53 LRRIYYFYCVSITFNVHLLFLL 74 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 147,316 Number of Sequences: 336 Number of extensions: 3220 Number of successful extensions: 7 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 16656800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -