BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20064 (713 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC458.03 |||nuclear telomere cap complex subunit |Schizosaccha... 29 0.87 SPAC24H6.11c |||sulfate transporter |Schizosaccharomyces pombe|c... 26 4.7 SPCC550.09 |||peroxin Pex32 |Schizosaccharomyces pombe|chr 3|||M... 26 6.1 SPBC32F12.01c ||SPBC685.10c|inositol phosphosphingolipid phospho... 25 8.1 SPBC119.16c |||conserved fungal protein|Schizosaccharomyces pomb... 25 8.1 SPBC543.07 |pek1|skh1, mkk1|MAP kinase kinase Pek1 |Schizosaccha... 25 8.1 >SPAC458.03 |||nuclear telomere cap complex subunit |Schizosaccharomyces pombe|chr 1|||Manual Length = 868 Score = 28.7 bits (61), Expect = 0.87 Identities = 19/68 (27%), Positives = 32/68 (47%) Frame = +3 Query: 234 ACSLTLSKSVILWEQQWHPCAIVGSMTIMYLLIWLLDLNTLASIAIVGLILNFVDFMVPV 413 A L KS E + H ++ ++ + L++ + + AIV L+L +D PV Sbjct: 533 ASKLIKRKSAFGTELRDHADELLQTLISLQNRFDLMNFDEMQMTAIVELLLTCLDICGPV 592 Query: 414 ICNQLYGS 437 IC L+ S Sbjct: 593 ICTNLFVS 600 >SPAC24H6.11c |||sulfate transporter |Schizosaccharomyces pombe|chr 1|||Manual Length = 958 Score = 26.2 bits (55), Expect = 4.7 Identities = 18/68 (26%), Positives = 33/68 (48%), Gaps = 5/68 (7%) Frame = +3 Query: 222 FRRLACSLTLSKSVILWEQQW-HPCAI----VGSMTIMYLLIWLLDLNTLASIAIVGLIL 386 F + + L LS ++ +Q+W HP I V + I Y+L+W + +L + G + Sbjct: 334 FAKWSIPLFLSSALEFAQQRWPHPFLIPSFFVIAPAIFYVLVWAIPGMSLEYLRETGWVF 393 Query: 387 NFVDFMVP 410 + + VP Sbjct: 394 SSTETNVP 401 >SPCC550.09 |||peroxin Pex32 |Schizosaccharomyces pombe|chr 3|||Manual Length = 535 Score = 25.8 bits (54), Expect = 6.1 Identities = 14/36 (38%), Positives = 19/36 (52%) Frame = +1 Query: 601 LDILFY*QHFPVVFIVNSSTALAWHTAHGISIVFFC 708 + IL + +FIV SS LAWH+ + V FC Sbjct: 267 MSILIFCLPTQALFIVLSSVFLAWHSP-PLQAVLFC 301 >SPBC32F12.01c ||SPBC685.10c|inositol phosphosphingolipid phospholipase C |Schizosaccharomyces pombe|chr 2|||Manual Length = 424 Score = 25.4 bits (53), Expect = 8.1 Identities = 17/56 (30%), Positives = 27/56 (48%), Gaps = 1/56 (1%) Frame = +3 Query: 531 SIPYEIPAHLCIT-LSPSVHCVL*LGYPLLLTTFSCCIYCQQ*YCFGLAYSAWDFN 695 SIP I H+ I P+ V+ L + ++LT + +C GL + W+FN Sbjct: 343 SIPLIIGVHVAIAWCDPAWLKVIILFFTVMLTIAAVV----NGFCIGLLFGRWEFN 394 >SPBC119.16c |||conserved fungal protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 448 Score = 25.4 bits (53), Expect = 8.1 Identities = 12/24 (50%), Positives = 15/24 (62%), Gaps = 1/24 (4%) Frame = -3 Query: 93 MQFDFFFHKLQGNYSKFVG-NQKE 25 ++FD F KLQGN +G N KE Sbjct: 150 LEFDSLFEKLQGNKFAILGANSKE 173 >SPBC543.07 |pek1|skh1, mkk1|MAP kinase kinase Pek1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 363 Score = 25.4 bits (53), Expect = 8.1 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = -1 Query: 521 CKSPIIVAYYNASTNFFKCLL 459 C SP IV YY A N +C L Sbjct: 132 CTSPYIVKYYGACYNNAECQL 152 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,981,703 Number of Sequences: 5004 Number of extensions: 61520 Number of successful extensions: 178 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 175 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 178 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 333194204 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -