BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20063 (681 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. 24 1.3 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 22 5.3 AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. 22 5.3 AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. 22 5.3 AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax pr... 21 7.1 AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax pr... 21 7.1 AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax pr... 21 7.1 AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax pr... 21 7.1 AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax pr... 21 7.1 AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax pr... 21 7.1 AF261823-1|AAG13010.1| 157|Tribolium castaneum cephalothorax pr... 21 7.1 AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduce... 21 7.1 DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase rever... 21 9.3 AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxida... 21 9.3 >AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. Length = 697 Score = 23.8 bits (49), Expect = 1.3 Identities = 10/32 (31%), Positives = 14/32 (43%) Frame = -3 Query: 178 KSPGASTRATCGDRLTVSVHTHRQVCPTSMLW 83 K PG S GD + + V H T++ W Sbjct: 104 KMPGPSVEVCLGDEVIIDVVNHLSSDSTTIHW 135 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 21.8 bits (44), Expect = 5.3 Identities = 11/44 (25%), Positives = 22/44 (50%) Frame = +2 Query: 518 QLDIATTKIMDFIKFESGNLCMITGGRNLGRVGTIVFPRETSRL 649 ++D + +++ + F G + GR+ V T+ PRE R+ Sbjct: 134 RIDNESQELLKYPSFARGRSLYDSRGRHSEIVETVYDPREDDRV 177 >AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. Length = 712 Score = 21.8 bits (44), Expect = 5.3 Identities = 8/30 (26%), Positives = 15/30 (50%) Frame = -3 Query: 172 PGASTRATCGDRLTVSVHTHRQVCPTSMLW 83 PG S + GD++ + V H + ++ W Sbjct: 172 PGPSIQVCEGDKVVIDVENHIEGNEVTLHW 201 Score = 21.0 bits (42), Expect = 9.3 Identities = 8/24 (33%), Positives = 15/24 (62%) Frame = +1 Query: 40 MARGPKKHLKRLNAPKAWMLDKLG 111 + R P +++K++N A LD+ G Sbjct: 609 IGRSPDQNVKKINLKHALDLDRRG 632 >AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. Length = 717 Score = 21.8 bits (44), Expect = 5.3 Identities = 8/30 (26%), Positives = 15/30 (50%) Frame = -3 Query: 172 PGASTRATCGDRLTVSVHTHRQVCPTSMLW 83 PG S + GD++ + V H + ++ W Sbjct: 172 PGPSIQVCEGDKVVIDVENHIEGNEVTLHW 201 Score = 21.0 bits (42), Expect = 9.3 Identities = 8/24 (33%), Positives = 15/24 (62%) Frame = +1 Query: 40 MARGPKKHLKRLNAPKAWMLDKLG 111 + R P +++K++N A LD+ G Sbjct: 609 IGRSPDQNVKKINLKHALDLDRQG 632 >AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 21.4 bits (43), Expect = 7.1 Identities = 10/40 (25%), Positives = 17/40 (42%) Frame = +3 Query: 372 HRITPEEAKYKLCKVKRVATGPKNVPYLVTHDGRTIRYPD 491 H + P Y + +R+A+ P TH + +Y D Sbjct: 64 HGLQPTMGDYTQLQPQRLASTHLQSPNTQTHPSASCKYAD 103 >AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 21.4 bits (43), Expect = 7.1 Identities = 10/40 (25%), Positives = 17/40 (42%) Frame = +3 Query: 372 HRITPEEAKYKLCKVKRVATGPKNVPYLVTHDGRTIRYPD 491 H + P Y + +R+A+ P TH + +Y D Sbjct: 64 HGLQPTMGDYTQLQPQRLASTHLQSPNTQTHPSASCKYAD 103 >AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax protein. Length = 230 Score = 21.4 bits (43), Expect = 7.1 Identities = 10/40 (25%), Positives = 17/40 (42%) Frame = +3 Query: 372 HRITPEEAKYKLCKVKRVATGPKNVPYLVTHDGRTIRYPD 491 H + P Y + +R+A+ P TH + +Y D Sbjct: 64 HGLQPTMGDYTQLQPQRLASTHLQSPNTQTHPSASCKYAD 103 >AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 21.4 bits (43), Expect = 7.1 Identities = 10/40 (25%), Positives = 17/40 (42%) Frame = +3 Query: 372 HRITPEEAKYKLCKVKRVATGPKNVPYLVTHDGRTIRYPD 491 H + P Y + +R+A+ P TH + +Y D Sbjct: 64 HGLQPTMGDYTQLQPQRLASTHLQSPNTQTHPSASCKYAD 103 >AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax protein. Length = 297 Score = 21.4 bits (43), Expect = 7.1 Identities = 10/40 (25%), Positives = 17/40 (42%) Frame = +3 Query: 372 HRITPEEAKYKLCKVKRVATGPKNVPYLVTHDGRTIRYPD 491 H + P Y + +R+A+ P TH + +Y D Sbjct: 64 HGLQPTMGDYTQLQPQRLASTHLQSPNTQTHPSASCKYAD 103 >AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax protein. Length = 268 Score = 21.4 bits (43), Expect = 7.1 Identities = 10/40 (25%), Positives = 17/40 (42%) Frame = +3 Query: 372 HRITPEEAKYKLCKVKRVATGPKNVPYLVTHDGRTIRYPD 491 H + P Y + +R+A+ P TH + +Y D Sbjct: 20 HGLQPTMGDYTQLQPQRLASTHLQSPNTQTHPSASCKYAD 59 >AF261823-1|AAG13010.1| 157|Tribolium castaneum cephalothorax protein. Length = 157 Score = 21.4 bits (43), Expect = 7.1 Identities = 10/40 (25%), Positives = 17/40 (42%) Frame = +3 Query: 372 HRITPEEAKYKLCKVKRVATGPKNVPYLVTHDGRTIRYPD 491 H + P Y + +R+A+ P TH + +Y D Sbjct: 64 HGLQPTMGDYTQLQPQRLASTHLQSPNTQTHPSASCKYAD 103 >AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduced Scr protein. Length = 312 Score = 21.4 bits (43), Expect = 7.1 Identities = 10/40 (25%), Positives = 17/40 (42%) Frame = +3 Query: 372 HRITPEEAKYKLCKVKRVATGPKNVPYLVTHDGRTIRYPD 491 H + P Y + +R+A+ P TH + +Y D Sbjct: 64 HGLQPTMGDYTQLQPQRLASTHLQSPNTQTHPSASCKYAD 103 >DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase reverse transcriptase protein. Length = 596 Score = 21.0 bits (42), Expect = 9.3 Identities = 7/21 (33%), Positives = 13/21 (61%) Frame = +1 Query: 388 RRLSTSCVKSSVWRPDLRMFR 450 R+++ C+KS WR L + + Sbjct: 525 RKVTFQCLKSIAWRAFLAVLK 545 >AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxidase subunit 1 protein. Length = 682 Score = 21.0 bits (42), Expect = 9.3 Identities = 10/25 (40%), Positives = 13/25 (52%) Frame = -1 Query: 585 IIHKFPDSNLMKSIIFVVAMSNWME 511 II +F L + VV +SNW E Sbjct: 239 IIARFNIERLCNGLKRVVKLSNWRE 263 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 175,813 Number of Sequences: 336 Number of extensions: 3969 Number of successful extensions: 19 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17801955 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -