BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20063 (681 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF437889-1|AAL84184.1| 155|Anopheles gambiae odorant binding pr... 24 5.1 AY146725-1|AAO12085.1| 155|Anopheles gambiae odorant-binding pr... 23 6.7 AY146724-1|AAO12084.1| 151|Anopheles gambiae odorant-binding pr... 23 6.7 AJ439353-11|CAD27933.1| 615|Anopheles gambiae 30E5.11 protein. 23 6.7 AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal... 23 6.7 AB090816-1|BAC57907.1| 455|Anopheles gambiae gag-like protein p... 23 6.7 AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. 23 8.9 >AF437889-1|AAL84184.1| 155|Anopheles gambiae odorant binding protein protein. Length = 155 Score = 23.8 bits (49), Expect = 5.1 Identities = 11/49 (22%), Positives = 24/49 (48%) Frame = +3 Query: 60 AFEALKRSQSMDVGQTWRCVCTETVNRSPQVARVLAPGDFPEESSEVCF 206 A ++L ++ ++ + R VC S ++A + G FP++ C+ Sbjct: 33 AQQSLTQADMDEIAKGMRKVCMSRPKISEEMANYPSQGIFPDDKEFKCY 81 >AY146725-1|AAO12085.1| 155|Anopheles gambiae odorant-binding protein AgamOBP6 protein. Length = 155 Score = 23.4 bits (48), Expect = 6.7 Identities = 11/49 (22%), Positives = 24/49 (48%) Frame = +3 Query: 60 AFEALKRSQSMDVGQTWRCVCTETVNRSPQVARVLAPGDFPEESSEVCF 206 A ++L ++ ++ + R VC S ++A + G FP++ C+ Sbjct: 33 AQQSLTQADMDEIAKGMRKVCMSRHKISEEMANYPSQGIFPDDQEFKCY 81 >AY146724-1|AAO12084.1| 151|Anopheles gambiae odorant-binding protein AgamOBP18 protein. Length = 151 Score = 23.4 bits (48), Expect = 6.7 Identities = 11/49 (22%), Positives = 24/49 (48%) Frame = +3 Query: 60 AFEALKRSQSMDVGQTWRCVCTETVNRSPQVARVLAPGDFPEESSEVCF 206 A ++L ++ ++ + R VC S ++A + G FP++ C+ Sbjct: 29 AQQSLTQADMDEIAKGMRKVCMSRHKISEEMANYPSQGIFPDDKEFKCY 77 >AJ439353-11|CAD27933.1| 615|Anopheles gambiae 30E5.11 protein. Length = 615 Score = 23.4 bits (48), Expect = 6.7 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = -2 Query: 482 ADGAAIMRYQVRNILRSGRHTLDFTQLVLS 393 AD AA +RY + + RH L + Q ++S Sbjct: 483 ADTAAELRYAKEHADKENRHFLQYAQDLIS 512 >AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal growth factor receptorprotein. Length = 1433 Score = 23.4 bits (48), Expect = 6.7 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = +1 Query: 604 GACGHHRVPARDIPALRHCAHQ 669 GA + VPA+D+P L H+ Sbjct: 1033 GARPYENVPAKDVPELIEIGHK 1054 >AB090816-1|BAC57907.1| 455|Anopheles gambiae gag-like protein protein. Length = 455 Score = 23.4 bits (48), Expect = 6.7 Identities = 15/60 (25%), Positives = 22/60 (36%) Frame = -2 Query: 239 CFTIFRTSFPVKAYFRRFLRKITRGKHSRNLWGPVDGLGAYTPPSLSNIHALGAFKRFKC 60 C + + PV +R R + RG +R+ PVD A +A KC Sbjct: 373 CISSIMEAMPVSVDRQRCYRCLERGHLARDCQSPVDRQQACIRCGADGHYAKSCTSEIKC 432 >AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. Length = 3361 Score = 23.0 bits (47), Expect = 8.9 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +2 Query: 611 VGTIVFPRETSRLFDIVHIKDST 679 V T FP ET +FDI I +T Sbjct: 1448 VDTTHFPTETKLVFDISFIPSTT 1470 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 797,478 Number of Sequences: 2352 Number of extensions: 17640 Number of successful extensions: 81 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 78 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 81 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 68577420 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -