BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20060 (530 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_40720| Best HMM Match : 7tm_3 (HMM E-Value=0) 103 9e-23 SB_31082| Best HMM Match : Motilin_ghrelin (HMM E-Value=0.23) 31 0.77 SB_1163| Best HMM Match : DMA (HMM E-Value=1.4e-11) 30 1.0 SB_57637| Best HMM Match : SRP40_C (HMM E-Value=2.3e-08) 30 1.4 SB_1824| Best HMM Match : Cupin_3 (HMM E-Value=1.6) 29 1.8 SB_55854| Best HMM Match : NinE (HMM E-Value=2.1) 29 1.8 SB_52319| Best HMM Match : Rho_N (HMM E-Value=1.8e-07) 28 4.1 SB_51340| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_24684| Best HMM Match : Phage_rep_O (HMM E-Value=2.3) 28 4.1 SB_10986| Best HMM Match : WD40 (HMM E-Value=0.026) 28 4.1 SB_24597| Best HMM Match : RNA_pol_delta (HMM E-Value=0.71) 28 5.4 SB_42767| Best HMM Match : Thyroglobulin_1 (HMM E-Value=0) 27 7.2 SB_1208| Best HMM Match : GRAM (HMM E-Value=0.0034) 27 7.2 SB_18296| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.2 SB_33068| Best HMM Match : Galactosyl_T (HMM E-Value=5.9e-37) 27 9.5 >SB_40720| Best HMM Match : 7tm_3 (HMM E-Value=0) Length = 768 Score = 103 bits (247), Expect = 9e-23 Identities = 46/60 (76%), Positives = 51/60 (85%) Frame = +3 Query: 75 QFRTHGTIPLSTYMKVYKVGDIVDIRGNGAVQKGMPHKVYHGKTGRVYNVTAHALGVIVN 254 +FR G LSTY+K YKVGDIVD++ NGAVQKGMPHKVYHGKTGRVYNVT ALGV+VN Sbjct: 440 KFRHRGVEHLSTYLKCYKVGDIVDVKANGAVQKGMPHKVYHGKTGRVYNVTKRALGVVVN 499 Score = 29.1 bits (62), Expect = 2.4 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = +1 Query: 25 MTNSKGYXXGTRDLFARSSAH 87 MTN+KGY GTR +F++ H Sbjct: 423 MTNTKGYRRGTRYMFSKKFRH 443 >SB_31082| Best HMM Match : Motilin_ghrelin (HMM E-Value=0.23) Length = 565 Score = 30.7 bits (66), Expect = 0.77 Identities = 19/51 (37%), Positives = 27/51 (52%), Gaps = 1/51 (1%) Frame = +2 Query: 335 FLKRVKENERLLKEAKAAGKTVNLKRQPA-PPKAAHIVSGTEKPVLLAPIP 484 F+KR + +R L+E A +NL ++PA P K + EKPV P P Sbjct: 272 FVKRTQRRQRELEEVADA---INLAKRPAQPEKPLKFLVKVEKPVPRPPTP 319 >SB_1163| Best HMM Match : DMA (HMM E-Value=1.4e-11) Length = 403 Score = 30.3 bits (65), Expect = 1.0 Identities = 17/49 (34%), Positives = 27/49 (55%) Frame = +2 Query: 221 RDCSCSRCDCQQRVRGRIIPKRINIRVEHVKHSKCRQDFLKRVKENERL 367 RDC+CS+C R R+ R+ I + K ++ R+ + +R EN RL Sbjct: 44 RDCTCSKCQLITE-RQRVTAARVAILRQQRKSAELREKY-QREMENVRL 90 >SB_57637| Best HMM Match : SRP40_C (HMM E-Value=2.3e-08) Length = 654 Score = 29.9 bits (64), Expect = 1.4 Identities = 19/67 (28%), Positives = 33/67 (49%), Gaps = 2/67 (2%) Frame = -2 Query: 385 SLGFLQ*PLILFDSLKEVLSALGVLDMLNTDIDAL--RYNPSANTLLTITPRA*AVTLYT 212 S+ F + I D+LK L + + TD++ + +YN + +TLL + T+ Sbjct: 227 SVSFRKIKSINIDTLKNDLRSSELHHSPKTDLNGIVKKYNQTLSTLLDSHAQVKIKTITN 286 Query: 211 RPVFPWY 191 RP PW+ Sbjct: 287 RPRLPWF 293 >SB_1824| Best HMM Match : Cupin_3 (HMM E-Value=1.6) Length = 305 Score = 29.5 bits (63), Expect = 1.8 Identities = 10/31 (32%), Positives = 19/31 (61%) Frame = +2 Query: 398 VNLKRQPAPPKAAHIVSGTEKPVLLAPIPYE 490 VN + PP A + ++ ++PVL P+P++ Sbjct: 130 VNKSKAETPPPAYYTITSNQEPVLNMPVPWQ 160 >SB_55854| Best HMM Match : NinE (HMM E-Value=2.1) Length = 271 Score = 29.5 bits (63), Expect = 1.8 Identities = 13/40 (32%), Positives = 25/40 (62%), Gaps = 1/40 (2%) Frame = +2 Query: 281 KRINIRVEH-VKHSKCRQDFLKRVKENERLLKEAKAAGKT 397 +RI ++H ++ K +QDF+ +KE RL +E+++ T Sbjct: 39 ERIQSCIDHKLEERKIKQDFVTLIKERNRLGRESRSGAST 78 >SB_52319| Best HMM Match : Rho_N (HMM E-Value=1.8e-07) Length = 1458 Score = 28.3 bits (60), Expect = 4.1 Identities = 18/60 (30%), Positives = 29/60 (48%) Frame = +2 Query: 281 KRINIRVEHVKHSKCRQDFLKRVKENERLLKEAKAAGKTVNLKRQPAPPKAAHIVSGTEK 460 K I + EH + S C Q F + N + ++ + GKT + + K HI+S +EK Sbjct: 413 KNIELLTEHWECSGCEQRFNRHDNYNRHVTEKRCSGGKTQLICK---GEKFKHIMSSSEK 469 >SB_51340| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4529 Score = 28.3 bits (60), Expect = 4.1 Identities = 15/71 (21%), Positives = 35/71 (49%) Frame = +2 Query: 281 KRINIRVEHVKHSKCRQDFLKRVKENERLLKEAKAAGKTVNLKRQPAPPKAAHIVSGTEK 460 +++ + K R + ++ + +RLL+++++ K L++ P P A + + E Sbjct: 1536 RKLTVEQREPYRLKARDNRVRLKDQEKRLLRQSESEKKHAALEQPPTP--APQVETQPET 1593 Query: 461 PVLLAPIPYEF 493 P+ A P+ F Sbjct: 1594 PIHQAASPFVF 1604 >SB_24684| Best HMM Match : Phage_rep_O (HMM E-Value=2.3) Length = 218 Score = 28.3 bits (60), Expect = 4.1 Identities = 27/98 (27%), Positives = 44/98 (44%), Gaps = 3/98 (3%) Frame = +2 Query: 92 NYSALHVHESVQSWRHCRHQRQWCSSKGYATQSIP--WKDRS-RVQRDCSCSRCDCQQRV 262 N A+ + ESV+SWR R++ + + + P DRS +V RCD Q Sbjct: 85 NPDAMLLRESVRSWRE-NIPRKYSDLRPTSLKISPSCVPDRSEKVGISFMSGRCDMQYHG 143 Query: 263 RGRIIPKRINIRVEHVKHSKCRQDFLKRVKENERLLKE 376 R +P+ + V + S+ R+ + V R L+E Sbjct: 144 ISRPVPESV-FEVTRIHQSRRRKRRVNHVTRAWRRLRE 180 >SB_10986| Best HMM Match : WD40 (HMM E-Value=0.026) Length = 528 Score = 28.3 bits (60), Expect = 4.1 Identities = 15/60 (25%), Positives = 32/60 (53%), Gaps = 2/60 (3%) Frame = +2 Query: 197 WKDRSRVQRDCSCSRCDCQQRVRG--RIIPKRINIRVEHVKHSKCRQDFLKRVKENERLL 370 WK++ ++ + C Q+ + + +P + + ++ ++ SKC Q+ L KEN RL+ Sbjct: 342 WKEQYIIRANWFSGHCHVQKLHQNEHKTLPHQ-SAKITCLRISKCSQNLLASAKENSRLV 400 >SB_24597| Best HMM Match : RNA_pol_delta (HMM E-Value=0.71) Length = 1139 Score = 27.9 bits (59), Expect = 5.4 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +2 Query: 161 CSSKGYATQSIPWKDRSRVQRDCSCSRCDCQQ 256 C+S + D+S VQ+DCS R DC + Sbjct: 736 CNSSDIGSTPTILSDKSPVQQDCSSIRRDCSR 767 >SB_42767| Best HMM Match : Thyroglobulin_1 (HMM E-Value=0) Length = 6725 Score = 27.5 bits (58), Expect = 7.2 Identities = 17/56 (30%), Positives = 26/56 (46%), Gaps = 3/56 (5%) Frame = +2 Query: 137 HC-RHQRQWCSSKGYATQSIPW--KDRSRVQRDCSCSRCDCQQRVRGRIIPKRINI 295 HC RH ++ + AT+ +PW KD S R C + C C + R++I Sbjct: 1275 HCQRHYQEKTRNWFLATRHVPWCRKDGSYDPRQCYKTDCFCVNEYGVYMSASRVDI 1330 >SB_1208| Best HMM Match : GRAM (HMM E-Value=0.0034) Length = 1021 Score = 27.5 bits (58), Expect = 7.2 Identities = 15/53 (28%), Positives = 25/53 (47%) Frame = +2 Query: 164 SSKGYATQSIPWKDRSRVQRDCSCSRCDCQQRVRGRIIPKRINIRVEHVKHSK 322 S K S WK+ +++++ C QQRV I +R+ + H K S+ Sbjct: 380 SEKSQKVHSANWKEEIQLRKELDCLNKQEQQRVSRISIEQRLAVDRFHRKLSR 432 >SB_18296| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 865 Score = 27.5 bits (58), Expect = 7.2 Identities = 15/45 (33%), Positives = 24/45 (53%) Frame = +3 Query: 303 SMSSTPSADKTSLRESKRMRGY*RKPRLPARPST*RDSQLPLKLP 437 ++S+ PS KT+ ++R RKP +PAR ST ++ P Sbjct: 633 TLSAPPSRPKTAPTSAQRTPEPIRKPLVPARMSTDSTDAFKIQAP 677 >SB_33068| Best HMM Match : Galactosyl_T (HMM E-Value=5.9e-37) Length = 646 Score = 27.1 bits (57), Expect = 9.5 Identities = 16/69 (23%), Positives = 30/69 (43%) Frame = +2 Query: 158 WCSSKGYATQSIPWKDRSRVQRDCSCSRCDCQQRVRGRIIPKRINIRVEHVKHSKCRQDF 337 WC ++ Y ++ + R+ +D S + + QRV +P N+R+ + QD Sbjct: 106 WCGARTYNKRASTLSTQPRLYQDSSKEQTEQHQRVGAEPVP-TTNVRLTLSTQPRLYQDP 164 Query: 338 LKRVKENER 364 K E + Sbjct: 165 SKEQTEQHQ 173 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,954,491 Number of Sequences: 59808 Number of extensions: 356162 Number of successful extensions: 1107 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 1039 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1104 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1191330434 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -