BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20058 (614 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF291654-1|AAG00600.1| 1340|Anopheles gambiae thioester-containi... 23 5.9 AF487780-1|AAL96667.1| 490|Anopheles gambiae cytochrome P450 CY... 23 7.8 >AF291654-1|AAG00600.1| 1340|Anopheles gambiae thioester-containing protein I protein. Length = 1340 Score = 23.4 bits (48), Expect = 5.9 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = +2 Query: 497 QVDRSSVKEGQEVTFRIAALD 559 QVD+ K G V FR+ LD Sbjct: 126 QVDKPVFKPGDTVNFRVILLD 146 >AF487780-1|AAL96667.1| 490|Anopheles gambiae cytochrome P450 CYP6Z2 protein protein. Length = 490 Score = 23.0 bits (47), Expect = 7.8 Identities = 10/32 (31%), Positives = 20/32 (62%) Frame = +1 Query: 145 CLVVKKITQNLALQPWCLGNIKESITNLLDYK 240 C + K+T+ +LQP + + E IT+ +D++ Sbjct: 224 CPGLLKLTRMTSLQPELIKFVMEIITHQIDHR 255 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 599,393 Number of Sequences: 2352 Number of extensions: 12193 Number of successful extensions: 11 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 60132501 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -