BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20058 (614 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g13260.1 68417.m02075 flavin-containing monooxygenase / FMO (... 29 1.9 At2g17140.1 68415.m01979 pentatricopeptide (PPR) repeat-containi... 28 4.3 At4g36140.1 68417.m05144 disease resistance protein (TIR-NBS-LRR... 27 7.5 At3g48730.1 68416.m05321 glutamate-1-semialdehyde 2,1-aminomutas... 27 7.5 >At4g13260.1 68417.m02075 flavin-containing monooxygenase / FMO (YUCCA2) identical to gi:16555354 Length = 415 Score = 29.5 bits (63), Expect = 1.9 Identities = 18/43 (41%), Positives = 24/43 (55%), Gaps = 1/43 (2%) Frame = -3 Query: 609 RLLSSNSPLM*GRAP*R-SKAAILKVTSWPSLTLDRSTCLQAL 484 R L P++ G P + AA LK PSL L+RSTC+ +L Sbjct: 21 RCLMIPGPIIVGSGPSGLATAACLKSRDIPSLILERSTCIASL 63 >At2g17140.1 68415.m01979 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 903 Score = 28.3 bits (60), Expect = 4.3 Identities = 21/68 (30%), Positives = 31/68 (45%), Gaps = 1/68 (1%) Frame = +1 Query: 49 HGYLTIWKLIIMSKIIKFDLRELKQLANDKNSCLVVKKI-TQNLALQPWCLGNIKESITN 225 H L + +I+ IK + E+ L ++ + I T N A+Q C G E TN Sbjct: 591 HKSLETYNSLILGLGIKNQIFEIHGLMDEMKEKGISPNICTYNTAIQYLCEGEKVEDATN 650 Query: 226 LLDYKVGK 249 LLD + K Sbjct: 651 LLDEMMQK 658 >At4g36140.1 68417.m05144 disease resistance protein (TIR-NBS-LRR class), putative domain signature TIR-NBS-LRR exists, suggestive of a disease resistance protein. Length = 1607 Score = 27.5 bits (58), Expect = 7.5 Identities = 10/24 (41%), Positives = 16/24 (66%) Frame = +1 Query: 142 SCLVVKKITQNLALQPWCLGNIKE 213 S +V+ +++N AL PWCL + E Sbjct: 103 SRIVIVVLSRNYALSPWCLDELVE 126 >At3g48730.1 68416.m05321 glutamate-1-semialdehyde 2,1-aminomutase 2 (GSA 2) / glutamate-1-semialdehyde aminotransferase 2 (GSA-AT 2) identical to GSA2 [SP|Q42522] Length = 472 Score = 27.5 bits (58), Expect = 7.5 Identities = 8/23 (34%), Positives = 16/23 (69%) Frame = -1 Query: 158 FTTKQEFLSFANCFNSRRSNFMI 90 FT KQ+F+ F C++ ++F++ Sbjct: 176 FTGKQKFIKFEGCYHGHANSFLV 198 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,107,736 Number of Sequences: 28952 Number of extensions: 230528 Number of successful extensions: 404 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 399 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 404 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1236350304 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -