BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20055 (759 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY769607-1|AAV40983.1| 196|Tribolium castaneum heat shock cogna... 107 9e-26 AY769606-1|AAV40982.1| 196|Tribolium castaneum heat shock prote... 107 9e-26 AY769608-1|AAV40984.1| 195|Tribolium castaneum heat shock prote... 98 8e-23 AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthol... 28 0.070 EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock prote... 23 2.6 EF222292-1|ABN79652.1| 354|Tribolium castaneum cardioactive pep... 23 3.5 DQ659253-1|ABG47451.1| 439|Tribolium castaneum imaginal disc gr... 23 3.5 Z69735-1|CAA93623.1| 162|Tribolium castaneum initiation factor ... 22 4.6 DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 prot... 22 4.6 EF222296-1|ABN79656.2| 403|Tribolium castaneum arginine vasopre... 21 8.1 >AY769607-1|AAV40983.1| 196|Tribolium castaneum heat shock cognate 70 protein. Length = 196 Score = 107 bits (257), Expect = 9e-26 Identities = 50/57 (87%), Positives = 53/57 (92%) Frame = +1 Query: 589 INEPTAAAIAYGLDKKGTGERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHFG 759 INEPTAAAIAYGLDKK ERNVLIFDLGGGTFDVS+LTIE+GIFEVK+TAGDTH G Sbjct: 1 INEPTAAAIAYGLDKKAEKERNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG 57 >AY769606-1|AAV40982.1| 196|Tribolium castaneum heat shock protein 70 protein. Length = 196 Score = 107 bits (257), Expect = 9e-26 Identities = 50/57 (87%), Positives = 53/57 (92%) Frame = +1 Query: 589 INEPTAAAIAYGLDKKGTGERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHFG 759 INEPTAAAIAYGLDKK ERNVLIFDLGGGTFDVS+LTIE+GIFEVK+TAGDTH G Sbjct: 1 INEPTAAAIAYGLDKKAERERNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLG 57 >AY769608-1|AAV40984.1| 195|Tribolium castaneum heat shock protein 70 protein. Length = 195 Score = 97.9 bits (233), Expect = 8e-23 Identities = 44/57 (77%), Positives = 53/57 (92%) Frame = +1 Query: 589 INEPTAAAIAYGLDKKGTGERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHFG 759 INEPTAAAIAYGLDKKG E+N+L++DLGGGTFDVSILTI++G+FEV +T+GDTH G Sbjct: 1 INEPTAAAIAYGLDKKGA-EQNILVYDLGGGTFDVSILTIDNGVFEVVATSGDTHLG 56 >AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthologue protein. Length = 431 Score = 28.3 bits (60), Expect = 0.070 Identities = 18/62 (29%), Positives = 28/62 (45%), Gaps = 2/62 (3%) Frame = +2 Query: 182 DHSVLCCVHRHRASHRRCRQEPGGVNPNNTIFDAKRLI--GRKFEDATVQADMKHWPFEV 355 DH + +H + SH +QEP G +N F RL+ D + ADM + + Sbjct: 342 DHQAM--LHHNPMSHH-LKQEPSGFTSSNHPFSINRLLPTAESKADIKMYADMHQYGYNT 398 Query: 356 VS 361 +S Sbjct: 399 LS 400 >EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock protein 90 protein. Length = 721 Score = 23.0 bits (47), Expect = 2.6 Identities = 14/42 (33%), Positives = 19/42 (45%) Frame = +2 Query: 362 DGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKT 487 D KPKI+ + ED+ E+ K K T + L KT Sbjct: 241 DKDKPKIEDVGEDEDEDTKKEDKKKKKTIKEKYTEDEELNKT 282 >EF222292-1|ABN79652.1| 354|Tribolium castaneum cardioactive peptide receptor 2 protein. Length = 354 Score = 22.6 bits (46), Expect = 3.5 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = +2 Query: 134 LPAREGGDHRQRPGQQDH 187 +P R+ DHR RP + H Sbjct: 246 IPIRQCDDHRDRPPRHFH 263 >DQ659253-1|ABG47451.1| 439|Tribolium castaneum imaginal disc growth factor 2 protein. Length = 439 Score = 22.6 bits (46), Expect = 3.5 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = +1 Query: 544 TKDAGTISGLNVLRIINEPTAA 609 TKDAG +S + ++N+P A Sbjct: 330 TKDAGLLSYPEICTLLNDPQNA 351 >Z69735-1|CAA93623.1| 162|Tribolium castaneum initiation factor 5-like protein protein. Length = 162 Score = 22.2 bits (45), Expect = 4.6 Identities = 9/20 (45%), Positives = 9/20 (45%) Frame = +1 Query: 466 RSLSWQNCAECSYHVPAYFN 525 RS Q C C YH P N Sbjct: 29 RSTISQGCKACGYHSPLESN 48 >DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 protein. Length = 980 Score = 22.2 bits (45), Expect = 4.6 Identities = 10/42 (23%), Positives = 20/42 (47%) Frame = +1 Query: 466 RSLSWQNCAECSYHVPAYFNDSQRQATKDAGTISGLNVLRII 591 R+ + N A+ H PA + TK++G ++ V ++ Sbjct: 336 RTFTLSNTAKFGVHAPASGGGKEGTYTKESGFLAYYEVCELL 377 >EF222296-1|ABN79656.2| 403|Tribolium castaneum arginine vasopressin receptor protein. Length = 403 Score = 21.4 bits (43), Expect = 8.1 Identities = 18/78 (23%), Positives = 37/78 (47%), Gaps = 1/78 (1%) Frame = -1 Query: 510 NVITAFCTVLPR*ASAVSFIFVSTMELTSSGKKVLSSPLYATLILGLPPSLTTSKGQCF- 334 ++ITAF +VLP+ A +++ F L K + Y + + + ++ + C+ Sbjct: 86 DLITAFLSVLPQLAWDITYRFYGGFLLCKVVKYGQTLGPYLSSYVLMATAIDRHQAICYP 145 Query: 333 MSACTVASSNLRPMRRLA 280 ++ C+ S + M LA Sbjct: 146 LTYCSWTSRRSKVMVYLA 163 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 191,292 Number of Sequences: 336 Number of extensions: 4435 Number of successful extensions: 14 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20338724 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -