BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20052 (684 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z79752-3|CAB02078.2| 130|Caenorhabditis elegans Hypothetical pr... 65 5e-11 AF040651-1|AAB95013.4| 691|Caenorhabditis elegans Nhl (ring fin... 31 1.0 >Z79752-3|CAB02078.2| 130|Caenorhabditis elegans Hypothetical protein D2005.3 protein. Length = 130 Score = 64.9 bits (151), Expect = 5e-11 Identities = 38/98 (38%), Positives = 56/98 (57%) Frame = +3 Query: 186 QSTTRKNASNGTS*THYIESSAKQDARARLNTIKLGRPEKAAMIENMICRMAQMGQIQCK 365 Q+ ++ A NG I Q A RL+ + + +PEKA M+E + MA+ GQ+ K Sbjct: 36 QAENQETAKNGM-----ISQILDQAAMQRLSNLAVAKPEKAQMVEAALINMARRGQLSGK 90 Query: 366 ITEPDLIQILESFNQQMPKSQSTVKFDRRRAALDSDDE 479 +T+ L ++E + Q K+ S VKFDRRR LDSD+E Sbjct: 91 MTDDGLKALMERVSAQTQKATS-VKFDRRRNELDSDEE 127 >AF040651-1|AAB95013.4| 691|Caenorhabditis elegans Nhl (ring finger b-box coiled coil)domain containing protein 3 protein. Length = 691 Score = 30.7 bits (66), Expect = 1.0 Identities = 13/32 (40%), Positives = 21/32 (65%) Frame = -2 Query: 98 ILKQFIVFSGSQFTTNQLIFCESCT*VPCSSC 3 I ++ +V S S T+QL++CE+C V C +C Sbjct: 102 IQRKDVVPSCSNHPTDQLLYCETCDLVFCENC 133 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,449,102 Number of Sequences: 27780 Number of extensions: 248342 Number of successful extensions: 464 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 451 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 463 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1560745544 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -