BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20052 (684 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g29850.2 68414.m03649 double-stranded DNA-binding family prot... 58 4e-09 At1g29850.1 68414.m03648 double-stranded DNA-binding family prot... 58 4e-09 At5g58350.1 68418.m07306 protein kinase family protein contains ... 27 8.8 At1g64630.1 68414.m07327 protein kinase family protein contains ... 27 8.8 >At1g29850.2 68414.m03649 double-stranded DNA-binding family protein contains Pfam profile: PF01984 double-stranded DNA-binding domain Length = 130 Score = 58.4 bits (135), Expect = 4e-09 Identities = 33/69 (47%), Positives = 43/69 (62%) Frame = +3 Query: 261 ARARLNTIKLGRPEKAAMIENMICRMAQMGQIQCKITEPDLIQILESFNQQMPKSQSTVK 440 AR R+ I L +PEKA +E++I R AQMGQI K++E LI +LE N Q K Q+ V Sbjct: 62 ARERIARIALVKPEKARGVEDVILRAAQMGQIVEKVSEERLITLLEQINSQTTK-QTKVT 120 Query: 441 FDRRRAALD 467 + RRR D Sbjct: 121 YQRRRGVDD 129 >At1g29850.1 68414.m03648 double-stranded DNA-binding family protein contains Pfam profile: PF01984 double-stranded DNA-binding domain Length = 129 Score = 58.4 bits (135), Expect = 4e-09 Identities = 33/69 (47%), Positives = 43/69 (62%) Frame = +3 Query: 261 ARARLNTIKLGRPEKAAMIENMICRMAQMGQIQCKITEPDLIQILESFNQQMPKSQSTVK 440 AR R+ I L +PEKA +E++I R AQMGQI K++E LI +LE N Q K Q+ V Sbjct: 61 ARERIARIALVKPEKARGVEDVILRAAQMGQIVEKVSEERLITLLEQINSQTTK-QTKVT 119 Query: 441 FDRRRAALD 467 + RRR D Sbjct: 120 YQRRRGVDD 128 >At5g58350.1 68418.m07306 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 571 Score = 27.5 bits (58), Expect = 8.8 Identities = 10/30 (33%), Positives = 20/30 (66%), Gaps = 2/30 (6%) Frame = -1 Query: 102 IHFKAIYRFL--WVTIHNKSINILRKLYIS 19 ++ K+I RF W+ +HN ++N + +L+ S Sbjct: 75 LNHKSIIRFYTSWIDVHNHTLNFITELFTS 104 >At1g64630.1 68414.m07327 protein kinase family protein contains eukaryotic protein kinase domain, INTERPRO:IPR000719; contains serine/threonine protein kinases active-site signature, PROSITE:PS00108 Length = 524 Score = 27.5 bits (58), Expect = 8.8 Identities = 10/20 (50%), Positives = 15/20 (75%) Frame = -1 Query: 78 FLWVTIHNKSINILRKLYIS 19 + WV HNKSIN++ +L+ S Sbjct: 82 YSWVDDHNKSINMITELFTS 101 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,395,223 Number of Sequences: 28952 Number of extensions: 221145 Number of successful extensions: 366 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 361 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 366 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1447936096 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -