BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20049 (646 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAPB2C8.01 |||glycoprotein |Schizosaccharomyces pombe|chr 1|||M... 33 0.047 SPCC584.15c |||arrestin/PY protein 2|Schizosaccharomyces pombe|c... 26 5.3 SPBP23A10.04 |apc2||anaphase-promoting complex subunit Apc2 |Sch... 25 9.3 SPAC17D4.03c |||membrane transporter |Schizosaccharomyces pombe|... 25 9.3 >SPAPB2C8.01 |||glycoprotein |Schizosaccharomyces pombe|chr 1|||Manual Length = 1220 Score = 32.7 bits (71), Expect = 0.047 Identities = 13/28 (46%), Positives = 18/28 (64%) Frame = +3 Query: 21 VLPGHSLCSCPRIITLASSSRTHYIFTM 104 V P SL CP+ +T+ SS +HYI T+ Sbjct: 41 VTPNTSLAQCPKYVTVYSSGSSHYISTI 68 >SPCC584.15c |||arrestin/PY protein 2|Schizosaccharomyces pombe|chr 3|||Manual Length = 594 Score = 25.8 bits (54), Expect = 5.3 Identities = 10/25 (40%), Positives = 13/25 (52%) Frame = -3 Query: 314 LMGILPSQHFFKQSHNSYTNHTELP 240 + G P++ F HNSY N LP Sbjct: 326 MFGARPTEGVFTGDHNSYVNENILP 350 >SPBP23A10.04 |apc2||anaphase-promoting complex subunit Apc2 |Schizosaccharomyces pombe|chr 2|||Manual Length = 681 Score = 25.0 bits (52), Expect = 9.3 Identities = 17/45 (37%), Positives = 24/45 (53%), Gaps = 3/45 (6%) Frame = +3 Query: 255 IRVAVMA-LFKKMLRRQYSHESG--KTELVRAQEEYLDRRRTRSL 380 + V +++ LF L +Y H G K EL EEY +R+R R L Sbjct: 458 LHVTILSRLFWPTLSVRYFHLPGPLKKELDAYAEEYRERKRKREL 502 >SPAC17D4.03c |||membrane transporter |Schizosaccharomyces pombe|chr 1|||Manual Length = 732 Score = 25.0 bits (52), Expect = 9.3 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 232 FREQTDHFHISND*NTNDNFCHH 164 + E+ DH IS ND+ CHH Sbjct: 554 YNEKCDHESISLQNLDNDHHCHH 576 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,859,583 Number of Sequences: 5004 Number of extensions: 61150 Number of successful extensions: 151 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 146 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 151 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 289756512 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -