BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20048 (771 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_3829| Best HMM Match : HLH (HMM E-Value=4.4e-12) 31 0.78 SB_59196| Best HMM Match : DUF593 (HMM E-Value=1.7) 28 7.3 >SB_3829| Best HMM Match : HLH (HMM E-Value=4.4e-12) Length = 1650 Score = 31.5 bits (68), Expect = 0.78 Identities = 22/76 (28%), Positives = 37/76 (48%), Gaps = 2/76 (2%) Frame = +2 Query: 434 YMGRESVFCGHPYQTECRRKYYTCFKRESIDYNVVIEDLQKRINEENPPLDNDEIELQDR 613 Y R S+ HPY TEC+ +Y E V +DL ++ ++ P ++ E L + Sbjct: 323 YDDRMSIKVRHPYPTECQSRYVIHMLTE----GVFADDLSQQPSQAGPQSESPE-SLANS 377 Query: 614 RG--HRMTWKQYHRLE 655 +G H MT ++ L+ Sbjct: 378 QGNSHEMTEFEHTELQ 393 >SB_59196| Best HMM Match : DUF593 (HMM E-Value=1.7) Length = 1376 Score = 28.3 bits (60), Expect = 7.3 Identities = 14/41 (34%), Positives = 25/41 (60%) Frame = +2 Query: 515 ESIDYNVVIEDLQKRINEENPPLDNDEIELQDRRGHRMTWK 637 E+++ +V++E + + I +E P L+ IEL R R +WK Sbjct: 954 ENVEESVLVEKVNEEIVDELP-LEETSIELVSLRVMRRSWK 993 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,414,402 Number of Sequences: 59808 Number of extensions: 436562 Number of successful extensions: 1274 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1166 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1274 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2095976575 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -