BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20048 (771 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF388659-2|AAK71994.1| 463|Apis mellifera 1D-myo-inositol-trisp... 25 0.78 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 24 1.4 >AF388659-2|AAK71994.1| 463|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform B protein. Length = 463 Score = 25.0 bits (52), Expect = 0.78 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +3 Query: 12 LRGGGSSKPPEPALQSKP 65 L+GGGS+ P P L + P Sbjct: 18 LKGGGSTTPASPTLSTPP 35 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 24.2 bits (50), Expect = 1.4 Identities = 14/43 (32%), Positives = 21/43 (48%) Frame = -3 Query: 130 LGPPRTTRPFASWIPWLLNVKFGFDCRAGSGGFDEPPPLSPRA 2 +G RT+ P W P + + C G D+ PPLSP++ Sbjct: 409 IGSRRTSPPPEDWKP----LDKCYFCLDGKLPHDDQPPLSPQS 447 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 202,929 Number of Sequences: 438 Number of extensions: 4333 Number of successful extensions: 10 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 24154023 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -