BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20040 (701 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthol... 21 7.4 AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein ... 21 9.7 >AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthologue protein. Length = 431 Score = 21.4 bits (43), Expect = 7.4 Identities = 11/43 (25%), Positives = 17/43 (39%) Frame = +3 Query: 249 HQDEWLTMEQTCYNMMRKQIQEEVAASIQYLAMGAYFSIDTVN 377 H D E CY +K+ ++E I+ S+D N Sbjct: 217 HPDSGNMFENGCYLRRQKRFKDEKKELIRQTHKSPSHSVDNSN 259 >AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein protein. Length = 370 Score = 21.0 bits (42), Expect = 9.7 Identities = 9/38 (23%), Positives = 18/38 (47%) Frame = +2 Query: 500 VQGPANTSWESGASALEHALKLESDVTNSIREVIKTCE 613 ++GP +W+ + + +V +S R+ TCE Sbjct: 101 IRGPKRKTWKVEEDSPSPTSSVSPEVKDSSRDRPFTCE 138 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 147,685 Number of Sequences: 336 Number of extensions: 2964 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18530690 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -