BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20040 (701 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-sy... 26 0.40 DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholi... 22 4.9 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 22 6.5 AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methylt... 22 6.5 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 21 8.6 >AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-synthase protein. Length = 504 Score = 25.8 bits (54), Expect = 0.40 Identities = 10/30 (33%), Positives = 17/30 (56%) Frame = +2 Query: 500 VQGPANTSWESGASALEHALKLESDVTNSI 589 ++ P SW S + + A KL+ ++ NSI Sbjct: 148 IRTPTEASWHSPEAHISVAQKLQKEIPNSI 177 >DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholine receptor beta1subunit protein. Length = 520 Score = 22.2 bits (45), Expect = 4.9 Identities = 9/28 (32%), Positives = 17/28 (60%) Frame = -3 Query: 591 RMLLVTSLSSLRACSRADAPLSHDVFAG 508 R+LL++++ + CS + L D+F G Sbjct: 10 RILLISAVFCVGLCSEDEERLVRDLFRG 37 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 21.8 bits (44), Expect = 6.5 Identities = 7/18 (38%), Positives = 14/18 (77%) Frame = +1 Query: 613 EQLQRLPPGRLFVRGIPR 666 ++L++LP G LF++ + R Sbjct: 1321 DRLRQLPEGSLFIKEVDR 1338 >AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methyltransferase protein. Length = 683 Score = 21.8 bits (44), Expect = 6.5 Identities = 10/24 (41%), Positives = 11/24 (45%) Frame = +1 Query: 10 ANRTYLFEFPANYKSPSTPVCVKA 81 A RTYLF+ N P V A Sbjct: 545 AGRTYLFDLDYNESEEQCPYTVDA 568 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 21.4 bits (43), Expect = 8.6 Identities = 10/31 (32%), Positives = 17/31 (54%) Frame = +1 Query: 547 RARPQAGE*RHQQHPGGHQDLREQLQRLPPG 639 +A+PQ + + QQ P Q ++Q Q+ G Sbjct: 827 QAQPQQQQQQQQQQPQQQQQQQQQQQQQQRG 857 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 180,480 Number of Sequences: 438 Number of extensions: 3289 Number of successful extensions: 9 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21561255 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -