BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20035 (493 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ151547-1|ABA39280.1| 405|Apis mellifera tyramine receptor pro... 23 1.3 EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. 23 2.3 AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisp... 23 2.3 AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. 22 3.1 AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. 22 3.1 AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. 22 3.1 AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. 22 3.1 AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. 22 3.1 AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. 22 3.1 AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. 22 3.1 AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex det... 22 3.1 AF069739-1|AAC63272.2| 690|Apis mellifera translation initiatio... 22 4.1 AY273778-1|AAP33487.1| 427|Apis mellifera ultraspiracle protein... 21 5.4 AF263459-1|AAF73057.1| 427|Apis mellifera ultraspiracle protein... 21 5.4 AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 21 7.1 AB086196-1|BAD06465.1| 289|Apis mellifera Period protein. 21 7.1 >DQ151547-1|ABA39280.1| 405|Apis mellifera tyramine receptor protein. Length = 405 Score = 23.4 bits (48), Expect = 1.3 Identities = 14/36 (38%), Positives = 20/36 (55%) Frame = +2 Query: 272 TDEAEVCICSRWQGPRHQYCQSWILQVARQRQTPQT 379 +DEAE S+ G + QS I +VAR+ +T T Sbjct: 272 SDEAEPSSTSKKSGIVRSHQQSCINRVARETKTAGT 307 >EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. Length = 570 Score = 22.6 bits (46), Expect = 2.3 Identities = 8/27 (29%), Positives = 15/27 (55%) Frame = +2 Query: 317 RHQYCQSWILQVARQRQTPQTTCHSKS 397 RH ++W+ R + TPQ+ S++ Sbjct: 241 RHLERKAWVASFGRPKMTPQSLLPSQT 267 >AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform A protein. Length = 782 Score = 22.6 bits (46), Expect = 2.3 Identities = 14/48 (29%), Positives = 21/48 (43%) Frame = -1 Query: 283 SLVCSETNVQAYLSSKLDRNSCSF*SGNFSYQVCQSIQDGTCPC*FCD 140 S+V S+ + +YL KL+RN + Q +C C CD Sbjct: 287 SVVVSDYSDYSYLDEKLERNDLDL--EKYEGISSTPSQASSCSCLDCD 332 >AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 3.1 Identities = 9/32 (28%), Positives = 20/32 (62%) Frame = +2 Query: 272 TDEAEVCICSRWQGPRHQYCQSWILQVARQRQ 367 ++++E + SR Q R + + W++Q R+R+ Sbjct: 20 SEDSETGLRSRTQEERLRRRREWMIQQERERE 51 >AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 3.1 Identities = 9/32 (28%), Positives = 20/32 (62%) Frame = +2 Query: 272 TDEAEVCICSRWQGPRHQYCQSWILQVARQRQ 367 ++++E + SR Q R + + W++Q R+R+ Sbjct: 20 SEDSETGLRSRTQEERLRRRREWMIQQERERE 51 >AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 3.1 Identities = 9/32 (28%), Positives = 20/32 (62%) Frame = +2 Query: 272 TDEAEVCICSRWQGPRHQYCQSWILQVARQRQ 367 ++++E + SR Q R + + W++Q R+R+ Sbjct: 20 SEDSETGLRSRTQEERLRRRREWMIQQERERE 51 >AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 3.1 Identities = 9/32 (28%), Positives = 20/32 (62%) Frame = +2 Query: 272 TDEAEVCICSRWQGPRHQYCQSWILQVARQRQ 367 ++++E + SR Q R + + W++Q R+R+ Sbjct: 20 SEDSETGLRSRTQEERLRRRREWMIQQERERE 51 >AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 3.1 Identities = 9/32 (28%), Positives = 20/32 (62%) Frame = +2 Query: 272 TDEAEVCICSRWQGPRHQYCQSWILQVARQRQ 367 ++++E + SR Q R + + W++Q R+R+ Sbjct: 20 SEDSETGLRSRTQEERLRRRREWMIQQERERE 51 >AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 3.1 Identities = 9/32 (28%), Positives = 20/32 (62%) Frame = +2 Query: 272 TDEAEVCICSRWQGPRHQYCQSWILQVARQRQ 367 ++++E + SR Q R + + W++Q R+R+ Sbjct: 20 SEDSETGLRSRTQEERLRRRREWMIQQERERE 51 >AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. Length = 400 Score = 22.2 bits (45), Expect = 3.1 Identities = 9/32 (28%), Positives = 20/32 (62%) Frame = +2 Query: 272 TDEAEVCICSRWQGPRHQYCQSWILQVARQRQ 367 ++++E + SR Q R + + W++Q R+R+ Sbjct: 20 SEDSETGLRSRTQEERLRRRREWMIQQERERE 51 >AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex determiner protein. Length = 401 Score = 22.2 bits (45), Expect = 3.1 Identities = 9/32 (28%), Positives = 20/32 (62%) Frame = +2 Query: 272 TDEAEVCICSRWQGPRHQYCQSWILQVARQRQ 367 ++++E + SR Q R + + W++Q R+R+ Sbjct: 20 SEDSETGLRSRTQEERLRRRREWMIQQERERE 51 >AF069739-1|AAC63272.2| 690|Apis mellifera translation initiation factor 2 protein. Length = 690 Score = 21.8 bits (44), Expect = 4.1 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +3 Query: 264 VSEQTRLKYASAPDGKVPVI 323 V EQT A D KVP+I Sbjct: 230 VKEQTLQSIEMAKDAKVPII 249 >AY273778-1|AAP33487.1| 427|Apis mellifera ultraspiracle protein protein. Length = 427 Score = 21.4 bits (43), Expect = 5.4 Identities = 10/26 (38%), Positives = 14/26 (53%) Frame = +2 Query: 257 DISL*TDEAEVCICSRWQGPRHQYCQ 334 D+S E + CI + Q R QYC+ Sbjct: 141 DLSYACREEKSCIIDKRQRNRCQYCR 166 >AF263459-1|AAF73057.1| 427|Apis mellifera ultraspiracle protein protein. Length = 427 Score = 21.4 bits (43), Expect = 5.4 Identities = 10/26 (38%), Positives = 14/26 (53%) Frame = +2 Query: 257 DISL*TDEAEVCICSRWQGPRHQYCQ 334 D+S E + CI + Q R QYC+ Sbjct: 141 DLSYACREEKSCIIDKRQRNRCQYCR 166 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 21.0 bits (42), Expect = 7.1 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = -1 Query: 298 ADAYFSLVCSETNVQAYLSSKLDRNS 221 +D+ +S CS + Q S + RNS Sbjct: 13 SDSGYSNTCSNSQSQRSSGSSISRNS 38 >AB086196-1|BAD06465.1| 289|Apis mellifera Period protein. Length = 289 Score = 21.0 bits (42), Expect = 7.1 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = -1 Query: 298 ADAYFSLVCSETNVQAYLSSKLDRNS 221 +D+ +S CS + Q S + RNS Sbjct: 13 SDSGYSNTCSNSQSQRSSGSSISRNS 38 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 128,096 Number of Sequences: 438 Number of extensions: 2763 Number of successful extensions: 16 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 13544190 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -