BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20030 (713 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY043292-1|AAK96031.1| 323|Tribolium castaneum homeodomain tran... 23 2.5 AF228509-1|AAF69136.1| 325|Tribolium castaneum prothoraxless pr... 23 2.5 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 22 5.7 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 22 5.7 EF222292-1|ABN79652.1| 354|Tribolium castaneum cardioactive pep... 21 7.5 AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 21 9.9 AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. 21 9.9 >AY043292-1|AAK96031.1| 323|Tribolium castaneum homeodomain transcription factor Prothoraxlessprotein. Length = 323 Score = 23.0 bits (47), Expect = 2.5 Identities = 8/25 (32%), Positives = 16/25 (64%) Frame = +1 Query: 154 YAWVLDKLKAERERRYHNRYCSLEV 228 Y W+ + + +R R+ + RY +LE+ Sbjct: 233 YPWMRSQFERKRGRQTYTRYQTLEL 257 >AF228509-1|AAF69136.1| 325|Tribolium castaneum prothoraxless protein. Length = 325 Score = 23.0 bits (47), Expect = 2.5 Identities = 8/25 (32%), Positives = 16/25 (64%) Frame = +1 Query: 154 YAWVLDKLKAERERRYHNRYCSLEV 228 Y W+ + + +R R+ + RY +LE+ Sbjct: 235 YPWMRSQFERKRGRQTYTRYQTLEL 259 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 21.8 bits (44), Expect = 5.7 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = -3 Query: 510 IFLLDFLKSGLTVWWFSGIHFVYSYDE 430 +FLL K L + W G+ +YDE Sbjct: 1283 VFLLTLKKDYLHIKWPFGVKTNITYDE 1309 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 21.8 bits (44), Expect = 5.7 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = -3 Query: 510 IFLLDFLKSGLTVWWFSGIHFVYSYDE 430 +FLL K L + W G+ +YDE Sbjct: 1283 VFLLTLKKDYLHIKWPFGVKTNITYDE 1309 >EF222292-1|ABN79652.1| 354|Tribolium castaneum cardioactive peptide receptor 2 protein. Length = 354 Score = 21.4 bits (43), Expect = 7.5 Identities = 9/31 (29%), Positives = 12/31 (38%) Frame = -2 Query: 529 IFLMYEDLPS*FPQIWAHCMVVQWNPFCLLL 437 +FL E PQ W QW + L+ Sbjct: 180 VFLFEEKQVQSMPQCWIDLQTWQWKVYITLV 210 Score = 21.0 bits (42), Expect = 9.9 Identities = 7/13 (53%), Positives = 9/13 (69%) Frame = +3 Query: 273 QRFHQEHDHRNLS 311 + FH+EHD R S Sbjct: 260 RHFHEEHDTRRAS 272 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 21.0 bits (42), Expect = 9.9 Identities = 8/26 (30%), Positives = 12/26 (46%) Frame = -3 Query: 588 CCLRAIQKWARKRQQLGCSQSS*CMR 511 CC A+ RQ + S+ C+R Sbjct: 615 CCYHAVAPGTDIRQSIALSRKKKCIR 640 >AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. Length = 682 Score = 21.0 bits (42), Expect = 9.9 Identities = 8/26 (30%), Positives = 12/26 (46%) Frame = -3 Query: 588 CCLRAIQKWARKRQQLGCSQSS*CMR 511 CC A+ RQ + S+ C+R Sbjct: 507 CCYHAVAPGTDIRQSIALSRKKKCIR 532 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 178,271 Number of Sequences: 336 Number of extensions: 3991 Number of successful extensions: 14 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18947110 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -