BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20027 (779 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 25 1.0 AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. 23 3.2 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 22 5.6 L10710-1|AAA27730.1| 382|Apis mellifera hyaluronidase protein. 21 9.7 AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamat... 21 9.7 AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamat... 21 9.7 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 24.6 bits (51), Expect = 1.0 Identities = 13/52 (25%), Positives = 26/52 (50%) Frame = +3 Query: 417 IPDAEAKSADIKVEEPAAQPEDSKTEVQATVLKFQKKKNLVLLMQKVLPTQL 572 +P EA ++ + +A P D ++ A K + N+ LL Q+ +P ++ Sbjct: 489 LPPREAPLVGVQPHQDSATPADQPLDLSAKP-KNSQDNNISLLEQQKIPLRM 539 >AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. Length = 652 Score = 23.0 bits (47), Expect = 3.2 Identities = 12/42 (28%), Positives = 23/42 (54%), Gaps = 4/42 (9%) Frame = +1 Query: 229 PTEVAAATERRKPNLLQLVTTR----YPLYQRPKRTI*PQKT 342 P V+ ++ R+P ++ T+ +P Y+RP+ T P+ T Sbjct: 130 PPSVSLSSPPREPGTPRINFTKLKRHHPRYKRPRTTFEPRAT 171 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 22.2 bits (45), Expect = 5.6 Identities = 5/14 (35%), Positives = 11/14 (78%) Frame = -1 Query: 473 LSSWFFHFNISRFC 432 +S+W +H N+++ C Sbjct: 1674 MSTWGYHHNVNKHC 1687 >L10710-1|AAA27730.1| 382|Apis mellifera hyaluronidase protein. Length = 382 Score = 21.4 bits (43), Expect = 9.7 Identities = 8/16 (50%), Positives = 13/16 (81%) Frame = -3 Query: 420 ESRMILLPGLFLRFSL 373 ES +LLP ++LR++L Sbjct: 249 ESEDVLLPSVYLRWNL 264 >AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamate receptor 1 protein. Length = 843 Score = 21.4 bits (43), Expect = 9.7 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = -1 Query: 257 LSVAAATSVGLTESSILGATS 195 L+ A TSVG+TE S+ S Sbjct: 812 LTAAVQTSVGVTEISLASNAS 832 >AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamate receptor protein. Length = 933 Score = 21.4 bits (43), Expect = 9.7 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = -1 Query: 257 LSVAAATSVGLTESSILGATS 195 L+ A TSVG+TE S+ S Sbjct: 902 LTAAVQTSVGVTEISLASNAS 922 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 167,743 Number of Sequences: 438 Number of extensions: 2813 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 24518154 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -