BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20022 (392 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY071732-1|AAL49354.1| 157|Drosophila melanogaster RH44960p pro... 127 5e-30 AY071136-1|AAL48758.1| 157|Drosophila melanogaster RE17737p pro... 127 5e-30 AE014297-251|AAF52027.1| 157|Drosophila melanogaster CG2099-PA ... 127 5e-30 >AY071732-1|AAL49354.1| 157|Drosophila melanogaster RH44960p protein. Length = 157 Score = 127 bits (307), Expect = 5e-30 Identities = 61/110 (55%), Positives = 75/110 (68%) Frame = +2 Query: 8 RLYAKAVFTGYKRGLRNQHENTALLKVEGAKDRNDAVFYAGKHCVYVYRAKKRTPIPGGP 187 RL+AKAVFTGYKRGLRNQHEN A+LK+EGA+ + FY GK CVYVY+A+ + +P P Sbjct: 49 RLFAKAVFTGYKRGLRNQHENQAILKIEGARRKEHGSFYVGKRCVYVYKAETKKCVPQHP 108 Query: 188 RGKKNQAACYLGQGDPPTWQLWRVRAKFKSNLPAQAMGHRIRVMLYPSRI 337 +K + G+ VRA+F NLP AMGHRIR+MLYPSRI Sbjct: 109 E-RKTRVRAVWGKVTRIHGNTGAVRARFNRNLPGHAMGHRIRIMLYPSRI 157 >AY071136-1|AAL48758.1| 157|Drosophila melanogaster RE17737p protein. Length = 157 Score = 127 bits (307), Expect = 5e-30 Identities = 61/110 (55%), Positives = 75/110 (68%) Frame = +2 Query: 8 RLYAKAVFTGYKRGLRNQHENTALLKVEGAKDRNDAVFYAGKHCVYVYRAKKRTPIPGGP 187 RL+AKAVFTGYKRGLRNQHEN A+LK+EGA+ + FY GK CVYVY+A+ + +P P Sbjct: 49 RLFAKAVFTGYKRGLRNQHENQAILKIEGARRKEHGSFYVGKRCVYVYKAETKKCVPQHP 108 Query: 188 RGKKNQAACYLGQGDPPTWQLWRVRAKFKSNLPAQAMGHRIRVMLYPSRI 337 +K + G+ VRA+F NLP AMGHRIR+MLYPSRI Sbjct: 109 E-RKTRVRAVWGKVTRIHGNTGAVRARFNRNLPGHAMGHRIRIMLYPSRI 157 >AE014297-251|AAF52027.1| 157|Drosophila melanogaster CG2099-PA protein. Length = 157 Score = 127 bits (307), Expect = 5e-30 Identities = 61/110 (55%), Positives = 75/110 (68%) Frame = +2 Query: 8 RLYAKAVFTGYKRGLRNQHENTALLKVEGAKDRNDAVFYAGKHCVYVYRAKKRTPIPGGP 187 RL+AKAVFTGYKRGLRNQHEN A+LK+EGA+ + FY GK CVYVY+A+ + +P P Sbjct: 49 RLFAKAVFTGYKRGLRNQHENQAILKIEGARRKEHGSFYVGKRCVYVYKAETKKCVPQHP 108 Query: 188 RGKKNQAACYLGQGDPPTWQLWRVRAKFKSNLPAQAMGHRIRVMLYPSRI 337 +K + G+ VRA+F NLP AMGHRIR+MLYPSRI Sbjct: 109 E-RKTRVRAVWGKVTRIHGNTGAVRARFNRNLPGHAMGHRIRIMLYPSRI 157 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,316,655 Number of Sequences: 53049 Number of extensions: 398938 Number of successful extensions: 1076 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1046 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1070 length of database: 24,988,368 effective HSP length: 77 effective length of database: 20,903,595 effective search space used: 1107890535 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -