BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20017 (763 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_A5D417 Cluster: N-terminal domain of molybdenum-binding... 33 5.8 >UniRef50_A5D417 Cluster: N-terminal domain of molybdenum-binding protein; n=1; Pelotomaculum thermopropionicum SI|Rep: N-terminal domain of molybdenum-binding protein - Pelotomaculum thermopropionicum SI Length = 110 Score = 33.5 bits (73), Expect = 5.8 Identities = 26/73 (35%), Positives = 39/73 (53%), Gaps = 3/73 (4%) Frame = +1 Query: 310 RYLIQIIKQHNSR-YSDAPY--FIRIESRTIDGSRSKG*YVINARFHNAWRILAASKDRA 480 R + +I +N + + D PY +R+E RT GS SK I ++ AWR++ A +DR Sbjct: 2 RLVCKIWLDNNGKAFGDGPYDLLLRVE-RT--GSLSKAAAEIGMSYNKAWRLIRAMEDRL 58 Query: 481 RHILLCVPAGPAN 519 LL AG A+ Sbjct: 59 GFPLLESKAGGAS 71 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 684,319,661 Number of Sequences: 1657284 Number of extensions: 12777983 Number of successful extensions: 24167 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 23618 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 24165 length of database: 575,637,011 effective HSP length: 99 effective length of database: 411,565,895 effective search space used: 63381147830 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -