BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20017 (763 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB072429-1|BAB83990.1| 388|Apis mellifera IP3phosphatase protein. 24 1.3 DQ325083-1|ABD14097.1| 189|Apis mellifera complementary sex det... 22 7.1 DQ494419-1|ABF55370.1| 127|Apis mellifera telomerase reverse tr... 21 9.4 DQ494418-1|ABF55369.1| 110|Apis mellifera telomerase reverse tr... 21 9.4 AY647436-1|AAU81605.1| 567|Apis mellifera juvenile hormone este... 21 9.4 AY526235-1|AAS20468.1| 169|Apis mellifera esterase protein. 21 9.4 AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisp... 21 9.4 AB083009-1|BAC54130.1| 567|Apis mellifera esterase protein. 21 9.4 >AB072429-1|BAB83990.1| 388|Apis mellifera IP3phosphatase protein. Length = 388 Score = 24.2 bits (50), Expect = 1.3 Identities = 7/12 (58%), Positives = 10/12 (83%) Frame = +1 Query: 337 HNSRYSDAPYFI 372 HN +YS+ PYF+ Sbjct: 214 HNDKYSNVPYFL 225 >DQ325083-1|ABD14097.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 21.8 bits (44), Expect = 7.1 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = +3 Query: 21 NTHNYQYPYPDLKNEVSSNY 80 N +NY+Y Y + N ++NY Sbjct: 92 NNNNYKYNYNNKYNYNNNNY 111 >DQ494419-1|ABF55370.1| 127|Apis mellifera telomerase reverse transcriptase protein. Length = 127 Score = 21.4 bits (43), Expect = 9.4 Identities = 10/33 (30%), Positives = 17/33 (51%) Frame = -3 Query: 656 KHTDRKLTTAVVSFVLNSLRAGTGSF*WKWKNQ 558 K T+ K+T ++ L S + + +KW NQ Sbjct: 67 KSTNEKITRYIIRMFLISQQKTSKLKIYKWNNQ 99 >DQ494418-1|ABF55369.1| 110|Apis mellifera telomerase reverse transcriptase protein. Length = 110 Score = 21.4 bits (43), Expect = 9.4 Identities = 10/33 (30%), Positives = 17/33 (51%) Frame = -3 Query: 656 KHTDRKLTTAVVSFVLNSLRAGTGSF*WKWKNQ 558 K T+ K+T ++ L S + + +KW NQ Sbjct: 50 KSTNEKITRYIIRMFLISQQKTSKLKIYKWNNQ 82 >AY647436-1|AAU81605.1| 567|Apis mellifera juvenile hormone esterase protein. Length = 567 Score = 21.4 bits (43), Expect = 9.4 Identities = 7/24 (29%), Positives = 13/24 (54%) Frame = -3 Query: 332 LIICIKYRPVRTHLRLLTTI*NYF 261 +I C++YRP R + L ++ Sbjct: 269 MIRCLRYRPARAIVETLANFMRFY 292 >AY526235-1|AAS20468.1| 169|Apis mellifera esterase protein. Length = 169 Score = 21.4 bits (43), Expect = 9.4 Identities = 7/24 (29%), Positives = 13/24 (54%) Frame = -3 Query: 332 LIICIKYRPVRTHLRLLTTI*NYF 261 +I C++YRP R + L ++ Sbjct: 140 MIRCLRYRPARAIVETLANFMRFY 163 >AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform A protein. Length = 782 Score = 21.4 bits (43), Expect = 9.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -2 Query: 663 SH*AHGS*ADHRSGELRFELAPS 595 S+ G+ +DH G LR+ PS Sbjct: 265 SNMVEGNESDHNDGRLRYWRTPS 287 >AB083009-1|BAC54130.1| 567|Apis mellifera esterase protein. Length = 567 Score = 21.4 bits (43), Expect = 9.4 Identities = 7/24 (29%), Positives = 13/24 (54%) Frame = -3 Query: 332 LIICIKYRPVRTHLRLLTTI*NYF 261 +I C++YRP R + L ++ Sbjct: 269 MIRCLRYRPARAIVETLANFMRFY 292 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 197,908 Number of Sequences: 438 Number of extensions: 4291 Number of successful extensions: 10 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 23789892 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -