BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20015 (627 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. 24 3.4 CR954257-5|CAJ14156.1| 227|Anopheles gambiae predicted protein ... 23 6.0 >AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. Length = 2259 Score = 24.2 bits (50), Expect = 3.4 Identities = 10/24 (41%), Positives = 12/24 (50%) Frame = -1 Query: 564 LRQASVNPVSPCWTLHQLLFCLKS 493 L A P CW LH L CL++ Sbjct: 194 LHGAGCTPERLCWELHYLERCLRA 217 >CR954257-5|CAJ14156.1| 227|Anopheles gambiae predicted protein protein. Length = 227 Score = 23.4 bits (48), Expect = 6.0 Identities = 9/32 (28%), Positives = 14/32 (43%) Frame = +2 Query: 434 RCTAKCSGDRSRYSYKST*SDFKQNNNWCKVQ 529 +CT R+ Y+ QNN CK++ Sbjct: 122 KCTRNVCTGRNEVPYREQCVKLHQNNRLCKIE 153 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 601,257 Number of Sequences: 2352 Number of extensions: 11676 Number of successful extensions: 17 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 61050630 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -