BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20014 (597 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value M93690-2|AAA29363.1| 1212|Anopheles gambiae unknown protein. 24 4.3 DQ974164-1|ABJ52804.1| 410|Anopheles gambiae serpin 4C protein. 23 7.5 AJ439060-1|CAD27752.1| 763|Anopheles gambiae hypothetical prote... 23 7.5 AJ438610-9|CAD27481.1| 763|Anopheles gambiae hypothetical prote... 23 7.5 AF444782-1|AAL37903.1| 576|Anopheles gambiae Toll9 protein. 23 7.5 >M93690-2|AAA29363.1| 1212|Anopheles gambiae unknown protein. Length = 1212 Score = 23.8 bits (49), Expect = 4.3 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = -2 Query: 257 VSTCEQTVLTAASSFLDPN 201 +S CE+T+ SSF DP+ Sbjct: 328 ISACEKTMQRMTSSFPDPH 346 >DQ974164-1|ABJ52804.1| 410|Anopheles gambiae serpin 4C protein. Length = 410 Score = 23.0 bits (47), Expect = 7.5 Identities = 7/14 (50%), Positives = 10/14 (71%) Frame = +1 Query: 355 LRYVTSWVRNTSEG 396 +RY+ SWV N + G Sbjct: 84 VRYINSWVHNQTHG 97 >AJ439060-1|CAD27752.1| 763|Anopheles gambiae hypothetical protein protein. Length = 763 Score = 23.0 bits (47), Expect = 7.5 Identities = 11/43 (25%), Positives = 20/43 (46%) Frame = -3 Query: 277 LVTPLIMFLHVNRLSSRRQAPFWIRTISQPSGDEGLPCECQQP 149 LVT ++ + R+++ F+ R S P G + P + P Sbjct: 339 LVTDVLSEFYNRRIAANANGLFYDRAGSVPGGSDSAPPKSNPP 381 >AJ438610-9|CAD27481.1| 763|Anopheles gambiae hypothetical protein protein. Length = 763 Score = 23.0 bits (47), Expect = 7.5 Identities = 11/43 (25%), Positives = 20/43 (46%) Frame = -3 Query: 277 LVTPLIMFLHVNRLSSRRQAPFWIRTISQPSGDEGLPCECQQP 149 LVT ++ + R+++ F+ R S P G + P + P Sbjct: 339 LVTDVLSEFYNRRIAANANGLFYDRAGSVPGGSDSAPPKSNPP 381 >AF444782-1|AAL37903.1| 576|Anopheles gambiae Toll9 protein. Length = 576 Score = 23.0 bits (47), Expect = 7.5 Identities = 9/29 (31%), Positives = 15/29 (51%) Frame = -2 Query: 287 LEAFSYSFNHVSTCEQTVLTAASSFLDPN 201 LE S+N++S Q +LT ++ N Sbjct: 206 LEQLDLSYNYISAWNQQILTTTTALQSVN 234 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 643,977 Number of Sequences: 2352 Number of extensions: 14638 Number of successful extensions: 18 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 18 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 57609459 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -