BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20014 (597 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cycl... 25 0.75 AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced prot... 22 4.0 AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. 22 5.3 DQ257631-1|ABB82366.1| 424|Apis mellifera yellow e3-like protei... 21 6.9 AY395073-1|AAQ96729.1| 203|Apis mellifera GABA neurotransmitter... 21 6.9 AB253415-1|BAE86926.1| 588|Apis mellifera alpha-glucosidase pro... 21 6.9 AY739659-1|AAU85298.1| 288|Apis mellifera hyperpolarization-act... 21 9.2 AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-act... 21 9.2 AY280848-1|AAQ16312.1| 632|Apis mellifera hyperpolarization-act... 21 9.2 AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 21 9.2 AB050744-1|BAB17753.1| 238|Apis mellifera period protein protein. 21 9.2 >AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cyclase alpha 1 subunit protein. Length = 699 Score = 24.6 bits (51), Expect = 0.75 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = -1 Query: 237 CPHGGKLLFGSEPFLN 190 CP +LF S PFLN Sbjct: 383 CPESDSILFVSSPFLN 398 >AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced protein 75 protein. Length = 900 Score = 22.2 bits (45), Expect = 4.0 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = +3 Query: 45 KSESQNPRRAYGPCEIAS 98 KS S +PR GPC+ S Sbjct: 880 KSPSPSPRPLVGPCKALS 897 >AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. Length = 996 Score = 21.8 bits (44), Expect = 5.3 Identities = 7/19 (36%), Positives = 10/19 (52%) Frame = +3 Query: 258 MIKGVTKGFQYKMRAVYAH 314 M++G+ G QY Y H Sbjct: 740 MLRGIASGMQYLAEMNYVH 758 >DQ257631-1|ABB82366.1| 424|Apis mellifera yellow e3-like protein protein. Length = 424 Score = 21.4 bits (43), Expect = 6.9 Identities = 10/28 (35%), Positives = 15/28 (53%) Frame = -2 Query: 326 VNGEVSIHSTHLVLEAFSYSFNHVSTCE 243 V EVSI L+ ++S+N V C+ Sbjct: 91 VTREVSIDGNPLIAPYPNWSYNDVKYCD 118 >AY395073-1|AAQ96729.1| 203|Apis mellifera GABA neurotransmitter transporter-1A protein. Length = 203 Score = 21.4 bits (43), Expect = 6.9 Identities = 9/13 (69%), Positives = 11/13 (84%) Frame = -2 Query: 539 FLISLFLTVVVAG 501 FLI FLT+V+AG Sbjct: 19 FLIPYFLTLVLAG 31 >AB253415-1|BAE86926.1| 588|Apis mellifera alpha-glucosidase protein. Length = 588 Score = 21.4 bits (43), Expect = 6.9 Identities = 16/59 (27%), Positives = 27/59 (45%) Frame = +3 Query: 330 VTTEGNSIIEIRNFLGEKYIRRVKMAPGVTVVNSPKQKDELIIRQLFRKMSLALVLSSS 506 V +GN IEI N +R+ + ++N K + I +L K + A + +SS Sbjct: 476 VLKKGNFTIEILNKTVLAVVRQSEEEAVSLLINFSKNNTIVDISKLVNKRNNAKIYTSS 534 >AY739659-1|AAU85298.1| 288|Apis mellifera hyperpolarization-activated ion channelvariant T protein. Length = 288 Score = 21.0 bits (42), Expect = 9.2 Identities = 7/13 (53%), Positives = 11/13 (84%) Frame = +1 Query: 337 LRVIQLLRYVTSW 375 LR+ +L+RYV+ W Sbjct: 220 LRLSRLVRYVSQW 232 >AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-activated ion channelvariant L protein. Length = 664 Score = 21.0 bits (42), Expect = 9.2 Identities = 7/13 (53%), Positives = 11/13 (84%) Frame = +1 Query: 337 LRVIQLLRYVTSW 375 LR+ +L+RYV+ W Sbjct: 220 LRLSRLVRYVSQW 232 >AY280848-1|AAQ16312.1| 632|Apis mellifera hyperpolarization-activated ion channel protein. Length = 632 Score = 21.0 bits (42), Expect = 9.2 Identities = 7/13 (53%), Positives = 11/13 (84%) Frame = +1 Query: 337 LRVIQLLRYVTSW 375 LR+ +L+RYV+ W Sbjct: 220 LRLSRLVRYVSQW 232 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 21.0 bits (42), Expect = 9.2 Identities = 8/19 (42%), Positives = 11/19 (57%) Frame = +3 Query: 9 GQTKPKHEANCSKSESQNP 65 G+ P HE SKS ++ P Sbjct: 521 GEISPHHEYYDSKSSTETP 539 >AB050744-1|BAB17753.1| 238|Apis mellifera period protein protein. Length = 238 Score = 21.0 bits (42), Expect = 9.2 Identities = 8/19 (42%), Positives = 11/19 (57%) Frame = +3 Query: 9 GQTKPKHEANCSKSESQNP 65 G+ P HE SKS ++ P Sbjct: 219 GEISPHHEYYDSKSSTETP 237 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 165,244 Number of Sequences: 438 Number of extensions: 3520 Number of successful extensions: 11 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 17482179 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -