BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20008 (705 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine rece... 22 4.9 AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 22 4.9 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 22 4.9 >AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine receptor protein. Length = 694 Score = 22.2 bits (45), Expect = 4.9 Identities = 9/35 (25%), Positives = 17/35 (48%) Frame = -1 Query: 600 NAGRKRNQLNGINIMSDDHNCAFFFSTSLVTCLCR 496 N L+ + ++S+D + FF +T + CR Sbjct: 435 NEDEDETPLDPVVVISNDKSTEFFLATVVEEAACR 469 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 22.2 bits (45), Expect = 4.9 Identities = 7/27 (25%), Positives = 17/27 (62%) Frame = +2 Query: 545 WSSLMMLIPLSWFLFLPALCRKMGVPY 625 W+++ +I L+W LF + ++ +P+ Sbjct: 110 WTNIYYIIILAWALFYLLVSLRIDLPW 136 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 22.2 bits (45), Expect = 4.9 Identities = 7/27 (25%), Positives = 17/27 (62%) Frame = +2 Query: 545 WSSLMMLIPLSWFLFLPALCRKMGVPY 625 W+++ +I L+W LF + ++ +P+ Sbjct: 163 WTNIYYIIILAWALFYLLVSLRIDLPW 189 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 181,688 Number of Sequences: 438 Number of extensions: 3588 Number of successful extensions: 5 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21683070 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -