BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20002 (732 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AK125488-1|BAC86180.1| 181|Homo sapiens protein ( Homo sapiens ... 34 0.46 BC112317-1|AAI12318.1| 1284|Homo sapiens zinc finger protein 423... 31 5.6 BC112315-1|AAI12316.1| 1284|Homo sapiens zinc finger protein 423... 31 5.6 AF221712-1|AAF28354.1| 1224|Homo sapiens Smad- and Olf-interacti... 31 5.6 AB018303-1|BAA34480.2| 1224|Homo sapiens KIAA0760 protein protein. 31 5.6 >AK125488-1|BAC86180.1| 181|Homo sapiens protein ( Homo sapiens cDNA FLJ43499 fis, clone PEBLM2002749. ). Length = 181 Score = 34.3 bits (75), Expect = 0.46 Identities = 18/38 (47%), Positives = 21/38 (55%), Gaps = 1/38 (2%) Frame = -3 Query: 364 GTKPLSPCTVYSTVMSLPSGRSTRYPPT-TLPSASPIR 254 GT+P P YSTV +PS PPT T PS+ P R Sbjct: 19 GTRPKKPPCAYSTVHRVPSAPEGPCPPTSTAPSSGPPR 56 >BC112317-1|AAI12318.1| 1284|Homo sapiens zinc finger protein 423 protein. Length = 1284 Score = 30.7 bits (66), Expect = 5.6 Identities = 15/49 (30%), Positives = 22/49 (44%) Frame = -2 Query: 362 YKATVALYCVLDRHESTVRKKHSVPPNDFAFSVTDSSRRSTMSSQDLQR 216 + + +YC LD H HSV P+ SV S + SS ++R Sbjct: 332 FSSVEGVYCHLDSHRQPDSSNHSVSPDPVLGSVASMSSATPDSSASVER 380 >BC112315-1|AAI12316.1| 1284|Homo sapiens zinc finger protein 423 protein. Length = 1284 Score = 30.7 bits (66), Expect = 5.6 Identities = 15/49 (30%), Positives = 22/49 (44%) Frame = -2 Query: 362 YKATVALYCVLDRHESTVRKKHSVPPNDFAFSVTDSSRRSTMSSQDLQR 216 + + +YC LD H HSV P+ SV S + SS ++R Sbjct: 332 FSSVEGVYCHLDSHRQPDSSNHSVSPDPVLGSVASMSSATPDSSASVER 380 >AF221712-1|AAF28354.1| 1224|Homo sapiens Smad- and Olf-interacting zinc finger protein protein. Length = 1224 Score = 30.7 bits (66), Expect = 5.6 Identities = 15/49 (30%), Positives = 22/49 (44%) Frame = -2 Query: 362 YKATVALYCVLDRHESTVRKKHSVPPNDFAFSVTDSSRRSTMSSQDLQR 216 + + +YC LD H HSV P+ SV S + SS ++R Sbjct: 272 FSSVEGVYCHLDSHRQPDSSNHSVSPDPVLGSVASMSSATPDSSASVER 320 >AB018303-1|BAA34480.2| 1224|Homo sapiens KIAA0760 protein protein. Length = 1224 Score = 30.7 bits (66), Expect = 5.6 Identities = 15/49 (30%), Positives = 22/49 (44%) Frame = -2 Query: 362 YKATVALYCVLDRHESTVRKKHSVPPNDFAFSVTDSSRRSTMSSQDLQR 216 + + +YC LD H HSV P+ SV S + SS ++R Sbjct: 272 FSSVEGVYCHLDSHRQPDSSNHSVSPDPVLGSVASMSSATPDSSASVER 320 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 92,440,379 Number of Sequences: 237096 Number of extensions: 1772231 Number of successful extensions: 7789 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7715 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7789 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 8679165170 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -