BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20001 (745 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY137766-1|AAM94344.1| 78|Anopheles gambiae heat shock protein... 97 4e-22 AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. 24 4.3 DQ974164-1|ABJ52804.1| 410|Anopheles gambiae serpin 4C protein. 24 5.7 >AY137766-1|AAM94344.1| 78|Anopheles gambiae heat shock protein 70 protein. Length = 78 Score = 97.5 bits (232), Expect = 4e-22 Identities = 46/53 (86%), Positives = 49/53 (92%) Frame = +3 Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDL 668 AYFNDSQRQATKDAG I+GLNV+RIINEPTAAA+AYGLDK GERNVLIFDL Sbjct: 8 AYFNDSQRQATKDAGAIAGLNVMRIINEPTAAALAYGLDKNLKGERNVLIFDL 60 Score = 29.9 bits (64), Expect = 0.087 Identities = 12/14 (85%), Positives = 14/14 (100%) Frame = +2 Query: 671 GGTFDVSILTIEDG 712 GGTFDVSILTI++G Sbjct: 62 GGTFDVSILTIDEG 75 >AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. Length = 3361 Score = 24.2 bits (50), Expect = 4.3 Identities = 14/36 (38%), Positives = 20/36 (55%), Gaps = 2/36 (5%) Frame = +2 Query: 71 NGKSTRSRNRSGYHVLLRWCLPAREGGDHR--QRPG 172 +GK RS + +++LL P REG H+ Q PG Sbjct: 1802 DGKYKRSYSYEPHNLLLSNLFPPREGFHHKAVQLPG 1837 >DQ974164-1|ABJ52804.1| 410|Anopheles gambiae serpin 4C protein. Length = 410 Score = 23.8 bits (49), Expect = 5.7 Identities = 9/23 (39%), Positives = 11/23 (47%) Frame = +2 Query: 191 LCCVHRHRASHRRCRQEPGGDDP 259 +CC+ R RR P DDP Sbjct: 322 VCCIESFRRRRRRDAFTPSKDDP 344 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 857,341 Number of Sequences: 2352 Number of extensions: 19001 Number of successful extensions: 73 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 70 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 73 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 76507752 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -