BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS01000 (676 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_01_0961 + 9566730-9566998,9567096-9567187,9567294-9567427,956... 40 0.002 07_03_1651 - 28395369-28395436,28395524-28395575,28395857-283960... 40 0.002 08_02_1329 - 26182762-26183007,26183149-26183249,26183533-261836... 39 0.004 07_03_1304 - 25629822-25629839,25630091-25631148,25631784-256349... 38 0.010 04_04_1247 - 32043776-32043880,32044296-32044505,32044595-320451... 38 0.010 01_06_0829 - 32270189-32270863 37 0.013 08_01_0413 - 3679887-3681254 37 0.017 02_03_0412 - 18749430-18749587,18749696-18749857,18750062-187501... 37 0.017 05_05_0173 + 22956927-22958615 36 0.022 01_06_1819 + 40110697-40110721,40110818-40110828,40111228-401115... 36 0.022 03_05_0677 + 26663880-26664581 36 0.039 01_06_1224 - 35508842-35510404 36 0.039 02_04_0653 - 24747959-24748276,24748847-24748959,24749815-247500... 35 0.052 03_05_0513 - 25073518-25073623,25073719-25073777,25074048-250741... 35 0.068 02_05_0084 - 25690346-25691206 35 0.068 12_02_1243 + 27300978-27301682 34 0.12 05_03_0471 - 14455543-14455650,14455925-14456002,14456121-144562... 33 0.16 05_01_0018 + 125697-126130,126231-126356,126726-126825,126950-12... 33 0.16 01_01_0475 + 3500385-3500880,3501078-3501154,3501851-3502019,350... 33 0.16 09_04_0706 + 19627024-19627380,19629945-19629976,19630657-196307... 33 0.21 04_03_0205 + 12649724-12650191,12651493-12652025,12652114-126522... 32 0.36 01_06_1809 - 40029628-40030539 32 0.36 08_02_1334 - 26224546-26225337 32 0.48 07_03_1459 + 26681619-26682419,26682600-26682912,26683861-26684672 32 0.48 04_03_0830 - 20125827-20125913,20126262-20126357,20126974-201270... 29 0.65 02_05_0890 - 32546918-32547088,32547224-32547334,32547705-325478... 31 0.84 01_06_1720 + 39421381-39421444,39422424-39422601,39422812-394229... 31 0.84 09_04_0651 - 19224403-19225032 31 1.1 07_01_1116 + 10308029-10308111,10308575-10308737,10308996-103090... 31 1.1 06_03_0474 + 21208643-21209266 29 4.5 06_01_0838 - 6360232-6360460,6360571-6360719,6360825-6360933,636... 29 4.5 01_06_0919 - 32993752-32993856,32994383-32994592,32994666-329952... 29 4.5 06_02_0066 - 11081446-11081544,11081639-11081846,11083122-110832... 28 5.9 03_02_0568 + 9514715-9514944,9515174-9515300,9515529-9515684,951... 28 5.9 11_04_0312 - 16259612-16260231,16260264-16262796 28 7.8 09_04_0144 + 15071723-15071993,15072078-15072632,15072671-150726... 28 7.8 01_05_0317 + 20822881-20822994,20824036-20824176,20824249-20825022 28 7.8 >12_01_0961 + 9566730-9566998,9567096-9567187,9567294-9567427, 9567542-9567591,9569026-9569100,9569179-9569734 Length = 391 Score = 39.9 bits (89), Expect = 0.002 Identities = 13/29 (44%), Positives = 18/29 (62%) Frame = +3 Query: 171 EYDCAVCLQKCQHPTKLSCGHVFCFLCVR 257 E CA+CL+ C P+ CGH FC C++ Sbjct: 161 ELSCAICLEICFEPSTTPCGHSFCMKCLK 189 >07_03_1651 - 28395369-28395436,28395524-28395575,28395857-28396092, 28396362-28396419,28396509-28396577,28396686-28396791, 28397104-28397171,28397266-28397385,28398144-28398231, 28399433-28399534,28399699-28399757,28399866-28400003, 28400222-28400473,28400508-28400593,28401061-28401165, 28402351-28402516 Length = 590 Score = 39.5 bits (88), Expect = 0.002 Identities = 12/24 (50%), Positives = 17/24 (70%) Frame = +3 Query: 180 CAVCLQKCQHPTKLSCGHVFCFLC 251 C++CL P LSCGH++C+LC Sbjct: 199 CSICLDTVFDPVALSCGHIYCYLC 222 >08_02_1329 - 26182762-26183007,26183149-26183249,26183533-26183602, 26183692-26183895,26186435-26186941,26188672-26188677 Length = 377 Score = 38.7 bits (86), Expect = 0.004 Identities = 12/28 (42%), Positives = 18/28 (64%) Frame = +3 Query: 174 YDCAVCLQKCQHPTKLSCGHVFCFLCVR 257 + C VCL K P+ +CGH+FC C++ Sbjct: 317 FTCPVCLNKLDKPSTTNCGHIFCEKCIQ 344 >07_03_1304 - 25629822-25629839,25630091-25631148,25631784-25634928, 25635454-25636293 Length = 1686 Score = 37.5 bits (83), Expect = 0.010 Identities = 15/30 (50%), Positives = 20/30 (66%), Gaps = 1/30 (3%) Frame = +3 Query: 168 MEYDCAVCLQKCQHPTKL-SCGHVFCFLCV 254 +E C +CL + + P KL SCGHVFC C+ Sbjct: 1520 LENACPICLCEVEDPFKLESCGHVFCLTCL 1549 >04_04_1247 - 32043776-32043880,32044296-32044505,32044595-32045101, 32045362-32045583,32046054-32046184,32046737-32047745, 32047830-32047904,32047995-32048066,32048153-32048328, 32048494-32048646,32048739-32049234 Length = 1051 Score = 37.5 bits (83), Expect = 0.010 Identities = 20/53 (37%), Positives = 27/53 (50%), Gaps = 4/53 (7%) Frame = +3 Query: 138 KHAVLIFSHNMEYDCAVCLQKCQHPTK----LSCGHVFCFLCVRV*LIKAENV 284 K V+ +E D A+C +C P + +CGHVFC+ CV L ENV Sbjct: 757 KETVINLLGQLEGDYAIC-SRCSDPPEDVVVATCGHVFCYQCVHKSLTSDENV 808 >01_06_0829 - 32270189-32270863 Length = 224 Score = 37.1 bits (82), Expect = 0.013 Identities = 15/44 (34%), Positives = 25/44 (56%), Gaps = 1/44 (2%) Frame = +3 Query: 174 YDCAVCLQKCQHPTKLSCGHVFCFLCVRV*L-IKAENVQCAAQK 302 ++C +CL+ Q P CGH+FC+ C+ L + A + +C K Sbjct: 25 FECNICLELAQDPVVTLCGHLFCWPCLYEWLHVHAHSRECPVCK 68 >08_01_0413 - 3679887-3681254 Length = 455 Score = 36.7 bits (81), Expect = 0.017 Identities = 10/30 (33%), Positives = 18/30 (60%) Frame = +3 Query: 165 NMEYDCAVCLQKCQHPTKLSCGHVFCFLCV 254 N ++C +C + + P CGH+FC+ C+ Sbjct: 236 NGSFECNICFESAKDPVVTPCGHLFCWPCI 265 >02_03_0412 - 18749430-18749587,18749696-18749857,18750062-18750194, 18751640-18751744,18751818-18751935,18752232-18752320, 18752407-18753660,18753785-18753831,18754285-18754339, 18754783-18754884 Length = 740 Score = 36.7 bits (81), Expect = 0.017 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +3 Query: 171 EYDCAVCLQKCQHPTKLSCGHVFCFLCV 254 E C +CL+ P SCGH++CF C+ Sbjct: 229 EVQCPICLESPLCPQITSCGHIYCFPCI 256 >05_05_0173 + 22956927-22958615 Length = 562 Score = 36.3 bits (80), Expect = 0.022 Identities = 10/27 (37%), Positives = 17/27 (62%) Frame = +3 Query: 174 YDCAVCLQKCQHPTKLSCGHVFCFLCV 254 ++C +C + P SCGH+FC+ C+ Sbjct: 236 FECNICFEMASEPVVTSCGHLFCWPCL 262 >01_06_1819 + 40110697-40110721,40110818-40110828,40111228-40111572, 40111707-40111782,40113605-40113771,40113818-40114036 Length = 280 Score = 36.3 bits (80), Expect = 0.022 Identities = 10/28 (35%), Positives = 18/28 (64%) Frame = +3 Query: 174 YDCAVCLQKCQHPTKLSCGHVFCFLCVR 257 ++C VC+ + P+ CGH+FC C++ Sbjct: 223 FNCPVCMNELVEPSSTICGHIFCKQCIK 250 >03_05_0677 + 26663880-26664581 Length = 233 Score = 35.5 bits (78), Expect = 0.039 Identities = 15/44 (34%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Frame = +3 Query: 174 YDCAVCLQKCQHPTKLSCGHVFCFLCV-RV*LIKAENVQCAAQK 302 ++C +C + Q P CGH+FC+ C+ R I A + +C K Sbjct: 22 FECNICFELPQEPIVTLCGHLFCWPCIYRWLHIHAHSPECPVCK 65 >01_06_1224 - 35508842-35510404 Length = 520 Score = 35.5 bits (78), Expect = 0.039 Identities = 10/27 (37%), Positives = 16/27 (59%) Frame = +3 Query: 174 YDCAVCLQKCQHPTKLSCGHVFCFLCV 254 ++C +C P SCGH+FC+ C+ Sbjct: 192 FECNICFDMASEPVVTSCGHLFCWPCL 218 >02_04_0653 - 24747959-24748276,24748847-24748959,24749815-24750015, 24750097-24750267,24750354-24750425,24751515-24751543, 24752161-24752303 Length = 348 Score = 35.1 bits (77), Expect = 0.052 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = +3 Query: 171 EYDCAVCLQKCQHPTKLSCGHVFCFLCV 254 + CA+C + P L+CGHV+C C+ Sbjct: 118 DVSCALCKELLYQPAVLNCGHVYCMSCL 145 >03_05_0513 - 25073518-25073623,25073719-25073777,25074048-25074185, 25074719-25074982,25075062-25075306,25075874-25076081 Length = 339 Score = 34.7 bits (76), Expect = 0.068 Identities = 15/38 (39%), Positives = 21/38 (55%), Gaps = 4/38 (10%) Frame = +3 Query: 150 LIFSHNMEYD----CAVCLQKCQHPTKLSCGHVFCFLC 251 + S M+Y+ C +CL +P LSCGH+FC C Sbjct: 221 MAISETMKYEYSLTCPICLDTLFNPYALSCGHLFCKGC 258 >02_05_0084 - 25690346-25691206 Length = 286 Score = 34.7 bits (76), Expect = 0.068 Identities = 10/27 (37%), Positives = 16/27 (59%) Frame = +3 Query: 174 YDCAVCLQKCQHPTKLSCGHVFCFLCV 254 +DC +CL P CGH++C+ C+ Sbjct: 49 FDCNICLDFATEPVVTLCGHLYCWPCI 75 >12_02_1243 + 27300978-27301682 Length = 234 Score = 33.9 bits (74), Expect = 0.12 Identities = 10/27 (37%), Positives = 17/27 (62%) Frame = +3 Query: 174 YDCAVCLQKCQHPTKLSCGHVFCFLCV 254 ++C +C + Q P CGH+FC+ C+ Sbjct: 23 FECNICFELPQEPIVTLCGHLFCWPCL 49 >05_03_0471 - 14455543-14455650,14455925-14456002,14456121-14456285, 14457151-14457261,14457863-14458024,14458462-14458538, 14459526-14460177 Length = 450 Score = 33.5 bits (73), Expect = 0.16 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = +3 Query: 180 CAVCLQKCQHPTKLSCGHVFCFLCV 254 CA+C +K P L C H+FC CV Sbjct: 423 CAICQEKMHVPVLLRCKHIFCEDCV 447 >05_01_0018 + 125697-126130,126231-126356,126726-126825,126950-126969, 127118-127220,127331-127469,127577-127791,127873-128523 Length = 595 Score = 33.5 bits (73), Expect = 0.16 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +3 Query: 171 EYDCAVCLQKCQHPTKLSCGHVFCFLCV 254 E+ C++C Q + P C H FC LC+ Sbjct: 308 EFGCSICKQVMKEPLTTPCAHNFCKLCL 335 >01_01_0475 + 3500385-3500880,3501078-3501154,3501851-3502019, 3502385-3502473,3502601-3502765,3502841-3502918, 3503087-3503190,3503317-3503422 Length = 427 Score = 33.5 bits (73), Expect = 0.16 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = +3 Query: 180 CAVCLQKCQHPTKLSCGHVFCFLCV 254 CA+C +K P L C H+FC CV Sbjct: 366 CAICQEKMHTPILLRCKHIFCEDCV 390 >09_04_0706 + 19627024-19627380,19629945-19629976,19630657-19630751, 19632116-19632281,19632881-19632938,19633014-19633061, 19633274-19633464,19633580-19633702,19635174-19635289, 19635841-19635924,19636009-19636259,19636438-19636647 Length = 576 Score = 33.1 bits (72), Expect = 0.21 Identities = 12/37 (32%), Positives = 21/37 (56%) Frame = +3 Query: 180 CAVCLQKCQHPTKLSCGHVFCFLCVRV*LIKAENVQC 290 C +C + P+ L+CGHV+C C+ + E ++C Sbjct: 406 CLICQELLFDPSVLNCGHVYCMPCLT--SVGGEELEC 440 >04_03_0205 + 12649724-12650191,12651493-12652025,12652114-12652239, 12652625-12652724,12652880-12652899,12653035-12653137, 12653213-12653351,12653448-12653662,12653772-12654320 Length = 750 Score = 32.3 bits (70), Expect = 0.36 Identities = 11/31 (35%), Positives = 15/31 (48%) Frame = +3 Query: 165 NMEYDCAVCLQKCQHPTKLSCGHVFCFLCVR 257 N +C+ C+ + P CGH FC C R Sbjct: 139 NKNINCSFCMLLPERPVTTPCGHNFCLKCFR 169 Score = 29.5 bits (63), Expect = 2.6 Identities = 9/28 (32%), Positives = 14/28 (50%) Frame = +3 Query: 171 EYDCAVCLQKCQHPTKLSCGHVFCFLCV 254 E+ C++C + P C H FC C+ Sbjct: 497 EFRCSICRNVMEEPVTTPCAHNFCKKCL 524 >01_06_1809 - 40029628-40030539 Length = 303 Score = 32.3 bits (70), Expect = 0.36 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +3 Query: 168 MEYDCAVCLQKCQHPTKLSCGHVFCFLCVR 257 M + C VC+ + + + CGH FC LC R Sbjct: 251 MVHVCCVCMVRHKGAAFIPCGHTFCRLCSR 280 >08_02_1334 - 26224546-26225337 Length = 263 Score = 31.9 bits (69), Expect = 0.48 Identities = 10/26 (38%), Positives = 14/26 (53%) Frame = +3 Query: 180 CAVCLQKCQHPTKLSCGHVFCFLCVR 257 C VC+ + + + CGH FC C R Sbjct: 215 CCVCMARAKGAAFIPCGHTFCRTCAR 240 >07_03_1459 + 26681619-26682419,26682600-26682912,26683861-26684672 Length = 641 Score = 31.9 bits (69), Expect = 0.48 Identities = 12/53 (22%), Positives = 27/53 (50%) Frame = +3 Query: 132 VLKHAVLIFSHNMEYDCAVCLQKCQHPTKLSCGHVFCFLCVRV*LIKAENVQC 290 +LK + +++C +CL SC H++C C+ + ++K+ + +C Sbjct: 379 LLKKLASLVDDGDDFECPICLAPPAKTVITSCTHIYCQTCI-MKILKSSSSRC 430 >04_03_0830 - 20125827-20125913,20126262-20126357,20126974-20127053, 20127124-20127220,20127457-20127544,20128491-20128576, 20129358-20130530 Length = 568 Score = 29.1 bits (62), Expect(2) = 0.65 Identities = 13/28 (46%), Positives = 17/28 (60%), Gaps = 1/28 (3%) Frame = -3 Query: 578 PLHPPPASMITSTELSH-CLEVNNDKVP 498 P HPPPAS +ST SH E ++ +P Sbjct: 71 PFHPPPASASSSTPTSHVAAESSSSSLP 98 Score = 21.0 bits (42), Expect(2) = 0.65 Identities = 13/29 (44%), Positives = 18/29 (62%) Frame = -3 Query: 500 PASSKVHSDSPLLKAFSNSELYAHHISTN 414 PA S V +DSP K+F S LY+ S++ Sbjct: 138 PAPSAVTADSPRKKSFW-SFLYSSSSSSS 165 >02_05_0890 - 32546918-32547088,32547224-32547334,32547705-32547884, 32547960-32548064,32548333-32548431,32548524-32548679, 32548772-32548850,32549213-32549278,32549382-32549536, 32549675-32550034,32550150-32550305,32550779-32550856, 32551471-32551812 Length = 685 Score = 31.1 bits (67), Expect = 0.84 Identities = 10/37 (27%), Positives = 18/37 (48%) Frame = +3 Query: 180 CAVCLQKCQHPTKLSCGHVFCFLCVRV*LIKAENVQC 290 C +C+ + +CGH FC++C+ L + C Sbjct: 60 CPICMAVIKDAFLTACGHSFCYMCIVTHLSHKSDCPC 96 >01_06_1720 + 39421381-39421444,39422424-39422601,39422812-39422980, 39423101-39423170,39423259-39423487,39425130-39425340 Length = 306 Score = 31.1 bits (67), Expect = 0.84 Identities = 10/29 (34%), Positives = 14/29 (48%) Frame = +3 Query: 171 EYDCAVCLQKCQHPTKLSCGHVFCFLCVR 257 E +C +CL+ C +C H C C R Sbjct: 207 EDECGICLETCTKMVLPNCNHAMCINCYR 235 >09_04_0651 - 19224403-19225032 Length = 209 Score = 30.7 bits (66), Expect = 1.1 Identities = 10/26 (38%), Positives = 14/26 (53%) Frame = +3 Query: 180 CAVCLQKCQHPTKLSCGHVFCFLCVR 257 C VC+ + + + CGH FC C R Sbjct: 161 CCVCMARGKAAAFIPCGHTFCRACAR 186 >07_01_1116 + 10308029-10308111,10308575-10308737,10308996-10309062, 10309120-10309375,10309658-10309781,10310039-10310077 Length = 243 Score = 30.7 bits (66), Expect = 1.1 Identities = 9/29 (31%), Positives = 14/29 (48%) Frame = +3 Query: 171 EYDCAVCLQKCQHPTKLSCGHVFCFLCVR 257 E +C +C++ C +C H C C R Sbjct: 160 EDECGICMETCTKMVLPNCSHAMCIKCYR 188 >06_03_0474 + 21208643-21209266 Length = 207 Score = 28.7 bits (61), Expect = 4.5 Identities = 13/50 (26%), Positives = 26/50 (52%) Frame = -3 Query: 566 PPASMITSTELSHCLEVNNDKVPASSKVHSDSPLLKAFSNSELYAHHIST 417 PP++ +T + C + +V A V + P++++F N + Y H + T Sbjct: 32 PPSTTTATTAAATCTSLVTQRVAAP--VRAVWPIVRSFGNPQRYKHFVRT 79 >06_01_0838 - 6360232-6360460,6360571-6360719,6360825-6360933, 6361446-6362276,6362865-6362969,6363084-6363180, 6363303-6363341,6363435-6363477 Length = 533 Score = 28.7 bits (61), Expect = 4.5 Identities = 19/48 (39%), Positives = 25/48 (52%), Gaps = 3/48 (6%) Frame = -3 Query: 578 PLHPPPASMITSTELSHCLEV-NNDKV--PASSKVHSDSPLLKAFSNS 444 PL PPP+S T++E S+ D V AS + +P LK SNS Sbjct: 141 PLTPPPSSSTTTSESSNGARTRRRDAVSRSASGNLFFHTPSLKMLSNS 188 >01_06_0919 - 32993752-32993856,32994383-32994592,32994666-32995220, 32995705-32995926,32996381-32996511,32997456-32998353, 32998453-32998530,32998612-32998683,32998728-32998763, 32999413-33000353,33000531-33000659,33000751-33000894, 33000994-33001060,33002434-33002502,33003144-33003278 Length = 1263 Score = 28.7 bits (61), Expect = 4.5 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = +3 Query: 138 KHAVLIFSHNMEYDCAVCLQKCQHPTKLSCGHVFCFLCV 254 + ++L+ + CA+C + CGHVFC C+ Sbjct: 956 QQSLLVCLQSCSAICALCNDAPEDAVVTICGHVFCNQCI 994 >06_02_0066 - 11081446-11081544,11081639-11081846,11083122-11083257, 11083339-11083541,11083616-11083765,11083848-11083964, 11084623-11085119 Length = 469 Score = 28.3 bits (60), Expect = 5.9 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = +3 Query: 180 CAVCLQKCQHPTKLSCGHVFCFLCVR 257 C +C ++ KL CGH+F C+R Sbjct: 260 CIICREEMTTAKKLLCGHLFHVHCLR 285 >03_02_0568 + 9514715-9514944,9515174-9515300,9515529-9515684, 9515765-9516102,9516191-9516329,9517083-9517152, 9517201-9517307,9517387-9517437,9517549-9517660, 9517783-9517869,9517958-9518133,9518479-9518586, 9518654-9518812,9518888-9518971,9519053-9519258, 9519565-9519666,9519768-9519877,9519963-9520114, 9520380-9520548,9520841-9520878,9521963-9522571, 9523314-9523784,9523786-9523871,9524396-9524906, 9525388-9525412,9526001-9526051,9526228-9526301, 9526412-9526534,9526667-9526738,9526924-9527020, 9527174-9527283 Length = 1649 Score = 28.3 bits (60), Expect = 5.9 Identities = 10/25 (40%), Positives = 13/25 (52%) Frame = +3 Query: 180 CAVCLQKCQHPTKLSCGHVFCFLCV 254 C +CL+ HP GH FC C+ Sbjct: 1185 CCLCLKPLIHPLCCPKGHTFCKECI 1209 >11_04_0312 - 16259612-16260231,16260264-16262796 Length = 1050 Score = 27.9 bits (59), Expect = 7.8 Identities = 15/41 (36%), Positives = 20/41 (48%) Frame = -1 Query: 199 FCKQTAQSYSILCEKINTACLSTHKLSHTYLPISKLLKYVC 77 FC+Q A Y I +KIN + ++S I KL VC Sbjct: 511 FCEQFAAPYEIAEDKINEKFKTCKRVSFINTSIEKLTAPVC 551 >09_04_0144 + 15071723-15071993,15072078-15072632,15072671-15072681, 15072954-15073012,15073962-15074040 Length = 324 Score = 27.9 bits (59), Expect = 7.8 Identities = 10/30 (33%), Positives = 17/30 (56%), Gaps = 3/30 (10%) Frame = +3 Query: 174 YDCAVCLQKCQHPTKLS---CGHVFCFLCV 254 + C+VC++K Q + + C H FC C+ Sbjct: 108 FKCSVCMEKLQVSEQFTVSFCAHAFCNSCI 137 >01_05_0317 + 20822881-20822994,20824036-20824176,20824249-20825022 Length = 342 Score = 27.9 bits (59), Expect = 7.8 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = +2 Query: 554 YSQAAGAKGYPTVTCQRNSRYKNQY*SKCQLK 649 Y + G G+ TC R S Y++ Y S C K Sbjct: 304 YCKQCGGHGHYNSTCGRKSSYESHYNSTCGRK 335 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,621,578 Number of Sequences: 37544 Number of extensions: 361208 Number of successful extensions: 938 Number of sequences better than 10.0: 37 Number of HSP's better than 10.0 without gapping: 903 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 938 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1714968940 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -