BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS01000 (676 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_4835| Best HMM Match : WWE (HMM E-Value=3.7e-19) 69 5e-12 SB_57045| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.052 SB_44019| Best HMM Match : TPR_2 (HMM E-Value=4.9e-12) 35 0.052 SB_29221| Best HMM Match : zf-C3HC4 (HMM E-Value=7.5e-10) 35 0.052 SB_9017| Best HMM Match : zf-C3HC4 (HMM E-Value=7.9e-12) 35 0.052 SB_39478| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.12 SB_39287| Best HMM Match : NHL (HMM E-Value=1.5e-21) 33 0.16 SB_18658| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.16 SB_30389| Best HMM Match : Helicase_C (HMM E-Value=3.3e-21) 33 0.21 SB_27532| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.37 SB_5526| Best HMM Match : zf-C3HC4 (HMM E-Value=2) 32 0.37 SB_7987| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.49 SB_6888| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.49 SB_57688| Best HMM Match : zf-C3HC4 (HMM E-Value=1.4e-08) 32 0.49 SB_56644| Best HMM Match : zf-C3HC4 (HMM E-Value=2.9e-07) 32 0.49 SB_43903| Best HMM Match : FHA (HMM E-Value=4.6e-13) 32 0.49 SB_30107| Best HMM Match : zf-C3HC4 (HMM E-Value=2.9e-07) 32 0.49 SB_30093| Best HMM Match : zf-C3HC4 (HMM E-Value=1.4e-08) 32 0.49 SB_14063| Best HMM Match : zf-C3HC4 (HMM E-Value=1.4e-08) 32 0.49 SB_54221| Best HMM Match : zf-B_box (HMM E-Value=2.1e-17) 31 0.85 SB_22201| Best HMM Match : zf-C3HC4 (HMM E-Value=8.1e-10) 31 0.85 SB_7188| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.85 SB_2107| Best HMM Match : zf-B_box (HMM E-Value=3.9e-08) 31 0.85 SB_27080| Best HMM Match : zf-C3HC4 (HMM E-Value=8.1e-10) 31 0.85 SB_11151| Best HMM Match : Neur_chan_memb (HMM E-Value=3.6e-10) 31 0.85 SB_40057| Best HMM Match : zf-B_box (HMM E-Value=1.4e-08) 31 1.1 SB_31692| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_22639| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_20056| Best HMM Match : zf-C3HC4 (HMM E-Value=9e-11) 31 1.1 SB_13725| Best HMM Match : zf-B_box (HMM E-Value=6e-14) 31 1.1 SB_35560| Best HMM Match : zf-B_box (HMM E-Value=1e-20) 31 1.1 SB_4488| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_33568| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.5 SB_18762| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.5 SB_46701| Best HMM Match : zf-B_box (HMM E-Value=1.4e-17) 30 2.0 SB_21628| Best HMM Match : zf-B_box (HMM E-Value=1.4e-17) 30 2.0 SB_6628| Best HMM Match : zf-C3HC4 (HMM E-Value=1e-09) 30 2.0 SB_51226| Best HMM Match : zf-C3HC4 (HMM E-Value=1e-09) 30 2.0 SB_47995| Best HMM Match : zf-C3HC4 (HMM E-Value=1e-09) 30 2.0 SB_43880| Best HMM Match : zf-B_box (HMM E-Value=5.1e-15) 30 2.0 SB_6802| Best HMM Match : zf-B_box (HMM E-Value=5e-18) 30 2.0 SB_52986| Best HMM Match : zf-C2H2 (HMM E-Value=0.0042) 29 2.6 SB_37011| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_28248| Best HMM Match : zf-C3HC4 (HMM E-Value=4e-10) 29 2.6 SB_26592| Best HMM Match : zf-B_box (HMM E-Value=1.3e-18) 29 2.6 SB_53640| Best HMM Match : zf-C3HC4 (HMM E-Value=4e-10) 29 2.6 SB_48401| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_48027| Best HMM Match : zf-C3HC4 (HMM E-Value=4e-10) 29 2.6 SB_41431| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_37498| Best HMM Match : MATH (HMM E-Value=1.8e-28) 29 2.6 SB_22421| Best HMM Match : zf-B_box (HMM E-Value=4e-17) 29 2.6 SB_11572| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_14352| Best HMM Match : NHL (HMM E-Value=2.8026e-45) 29 3.4 SB_16517| Best HMM Match : zf-C3HC4 (HMM E-Value=1e-07) 29 3.4 SB_5620| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.4 SB_4090| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.4 SB_57762| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.5 SB_44886| Best HMM Match : zf-C3HC4 (HMM E-Value=1.3e-06) 29 4.5 SB_37786| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.5 SB_36597| Best HMM Match : zf-C3HC4 (HMM E-Value=2.9e-07) 29 4.5 SB_18515| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.5 SB_944| Best HMM Match : zf-B_box (HMM E-Value=6.7e-15) 29 4.5 SB_50665| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.5 SB_38753| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.5 SB_38368| Best HMM Match : zf-C3HC4 (HMM E-Value=4.4e-15) 29 4.5 SB_23299| Best HMM Match : zf-C3HC4 (HMM E-Value=5.9e-06) 29 4.5 SB_22842| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.5 SB_25899| Best HMM Match : Ribonuc_2-5A (HMM E-Value=0) 28 6.0 SB_24485| Best HMM Match : zf-CCCH (HMM E-Value=3e-09) 28 6.0 SB_5773| Best HMM Match : HA2 (HMM E-Value=3e-16) 28 6.0 SB_58031| Best HMM Match : DB (HMM E-Value=1.5) 28 7.9 SB_16508| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.9 SB_10749| Best HMM Match : DB (HMM E-Value=1.5) 28 7.9 >SB_4835| Best HMM Match : WWE (HMM E-Value=3.7e-19) Length = 320 Score = 68.5 bits (160), Expect = 5e-12 Identities = 31/74 (41%), Positives = 44/74 (59%), Gaps = 5/74 (6%) Frame = +2 Query: 236 FLFSLCEGVAHQSRKCAMCRTEIPLDYFENPVLL-----DKSNLQYAANVDGVEGFQWYY 400 F F +GVA +SRKCA+CR I DY + P L+ S+ A + + + W+Y Sbjct: 90 FCFLCIKGVALRSRKCAICRQPISPDYLDKPTLVKVVSGQSSSSDKAPSDPPADEYVWFY 149 Query: 401 EGRNGWWKYDERTT 442 EGRNGWW+YD +T+ Sbjct: 150 EGRNGWWQYDTKTS 163 Score = 52.4 bits (120), Expect = 3e-07 Identities = 18/35 (51%), Positives = 26/35 (74%) Frame = +3 Query: 153 IFSHNMEYDCAVCLQKCQHPTKLSCGHVFCFLCVR 257 IF + + DC VCLQ+ +P +L CGH+FCFLC++ Sbjct: 62 IFELDYQPDCPVCLQQASYPVRLPCGHMFCFLCIK 96 >SB_57045| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 362 Score = 35.1 bits (77), Expect = 0.052 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +3 Query: 171 EYDCAVCLQKCQHPTKLSCGHVFCFLCV 254 E +C +CL++ + P L C H FC+ C+ Sbjct: 13 EVECPICLERFKDPRVLPCLHTFCYECL 40 >SB_44019| Best HMM Match : TPR_2 (HMM E-Value=4.9e-12) Length = 654 Score = 35.1 bits (77), Expect = 0.052 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = +3 Query: 171 EYDCAVCLQKCQHPTKLSCGHVFCFLCV 254 E++C +C + +P CGHVFC C+ Sbjct: 376 EFECTLCCRLFYNPVTTPCGHVFCRACL 403 >SB_29221| Best HMM Match : zf-C3HC4 (HMM E-Value=7.5e-10) Length = 337 Score = 35.1 bits (77), Expect = 0.052 Identities = 14/40 (35%), Positives = 21/40 (52%) Frame = +3 Query: 171 EYDCAVCLQKCQHPTKLSCGHVFCFLCVRV*LIKAENVQC 290 ++ C +CLQ P L C H FC +C ++ N+QC Sbjct: 34 DFTCPICLQLLVEPVVLPCEHEFCKMCFTQ-NVQEANLQC 72 >SB_9017| Best HMM Match : zf-C3HC4 (HMM E-Value=7.9e-12) Length = 203 Score = 35.1 bits (77), Expect = 0.052 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +3 Query: 171 EYDCAVCLQKCQHPTKLSCGHVFCFLCV 254 E +C +CL++ + P L C H FC+ C+ Sbjct: 13 EVECPICLERFKDPRVLPCLHTFCYECL 40 >SB_39478| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 254 Score = 33.9 bits (74), Expect = 0.12 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = +3 Query: 159 SHNMEYDCAVCLQKCQHPTKLSCGHVFCFLCV 254 S N ++C +CL + CGH+FC+ C+ Sbjct: 56 SANANFECNICLDTARDAVISMCGHLFCWPCL 87 >SB_39287| Best HMM Match : NHL (HMM E-Value=1.5e-21) Length = 645 Score = 33.5 bits (73), Expect = 0.16 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +3 Query: 171 EYDCAVCLQKCQHPTKLSCGHVFCFLCV 254 E C+VCL++ + P L C H FC C+ Sbjct: 19 ELTCSVCLEQFREPKMLPCFHTFCKECL 46 >SB_18658| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 337 Score = 33.5 bits (73), Expect = 0.16 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = +3 Query: 171 EYDCAVCLQKCQHPTKLSCGHVFCFLCV 254 ++ C +C + P +CGHVFC C+ Sbjct: 54 DFKCGICFGVLEDPLVTTCGHVFCSQCL 81 >SB_30389| Best HMM Match : Helicase_C (HMM E-Value=3.3e-21) Length = 380 Score = 33.1 bits (72), Expect = 0.21 Identities = 11/41 (26%), Positives = 20/41 (48%) Frame = +3 Query: 132 VLKHAVLIFSHNMEYDCAVCLQKCQHPTKLSCGHVFCFLCV 254 ++ + + S + +C +CL P+ C HVFC C+ Sbjct: 49 LINQLLQVLSSGVSEECPICLDPLDDPSITRCAHVFCTGCL 89 >SB_27532| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 649 Score = 32.3 bits (70), Expect = 0.37 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = +3 Query: 180 CAVCLQKCQHPTKLSCGHVFCFLCVR 257 C VCL + ++P L C H FC CV+ Sbjct: 20 CPVCLGEYKNPMLLRCYHSFCLRCVQ 45 >SB_5526| Best HMM Match : zf-C3HC4 (HMM E-Value=2) Length = 106 Score = 32.3 bits (70), Expect = 0.37 Identities = 9/28 (32%), Positives = 18/28 (64%) Frame = +3 Query: 174 YDCAVCLQKCQHPTKLSCGHVFCFLCVR 257 + C++C + P + +C HVFC+ C++ Sbjct: 79 HQCSICSEPPTAPHQGACEHVFCYYCIK 106 >SB_7987| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 466 Score = 31.9 bits (69), Expect = 0.49 Identities = 10/25 (40%), Positives = 13/25 (52%) Frame = +3 Query: 180 CAVCLQKCQHPTKLSCGHVFCFLCV 254 CA+C + P C H FC LC+ Sbjct: 160 CAICKEVLTQPIATPCDHYFCVLCI 184 >SB_6888| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1257 Score = 31.9 bits (69), Expect = 0.49 Identities = 12/26 (46%), Positives = 18/26 (69%), Gaps = 1/26 (3%) Frame = +3 Query: 180 CAVCLQKCQHPTKLS-CGHVFCFLCV 254 C +C + +PT LS CG+VFC+ C+ Sbjct: 1201 CPLCAKVRTNPTALSTCGYVFCYPCI 1226 >SB_57688| Best HMM Match : zf-C3HC4 (HMM E-Value=1.4e-08) Length = 262 Score = 31.9 bits (69), Expect = 0.49 Identities = 10/25 (40%), Positives = 13/25 (52%) Frame = +3 Query: 180 CAVCLQKCQHPTKLSCGHVFCFLCV 254 CA+C + P C H FC LC+ Sbjct: 34 CAICKEVLTQPIATPCDHYFCVLCI 58 >SB_56644| Best HMM Match : zf-C3HC4 (HMM E-Value=2.9e-07) Length = 858 Score = 31.9 bits (69), Expect = 0.49 Identities = 11/27 (40%), Positives = 16/27 (59%), Gaps = 1/27 (3%) Frame = +3 Query: 177 DCAVCLQKCQHPTKLS-CGHVFCFLCV 254 +C +CL+ +P L CGH FC C+ Sbjct: 677 ECPICLETITYPETLQGCGHTFCRPCI 703 >SB_43903| Best HMM Match : FHA (HMM E-Value=4.6e-13) Length = 553 Score = 31.9 bits (69), Expect = 0.49 Identities = 16/46 (34%), Positives = 22/46 (47%), Gaps = 3/46 (6%) Frame = +3 Query: 171 EYDCAVCLQKCQHPTKLSCGHVFCFLCVRV*LIKAEN---VQCAAQ 299 E+ C VC + T L+C H FC C++ L K +CA Q Sbjct: 368 EFSCIVCQELFIRATTLTCSHSFCEYCLQSWLRKRNTCPICRCAVQ 413 >SB_30107| Best HMM Match : zf-C3HC4 (HMM E-Value=2.9e-07) Length = 911 Score = 31.9 bits (69), Expect = 0.49 Identities = 11/27 (40%), Positives = 16/27 (59%), Gaps = 1/27 (3%) Frame = +3 Query: 177 DCAVCLQKCQHPTKLS-CGHVFCFLCV 254 +C +CL+ +P L CGH FC C+ Sbjct: 752 ECPICLETITYPETLQGCGHTFCRPCI 778 >SB_30093| Best HMM Match : zf-C3HC4 (HMM E-Value=1.4e-08) Length = 301 Score = 31.9 bits (69), Expect = 0.49 Identities = 10/25 (40%), Positives = 13/25 (52%) Frame = +3 Query: 180 CAVCLQKCQHPTKLSCGHVFCFLCV 254 CA+C + P C H FC LC+ Sbjct: 160 CAICKEVLTQPIATPCDHYFCVLCI 184 >SB_14063| Best HMM Match : zf-C3HC4 (HMM E-Value=1.4e-08) Length = 301 Score = 31.9 bits (69), Expect = 0.49 Identities = 10/25 (40%), Positives = 13/25 (52%) Frame = +3 Query: 180 CAVCLQKCQHPTKLSCGHVFCFLCV 254 CA+C + P C H FC LC+ Sbjct: 160 CAICKEVLTQPIATPCDHYFCVLCI 184 >SB_54221| Best HMM Match : zf-B_box (HMM E-Value=2.1e-17) Length = 455 Score = 31.1 bits (67), Expect = 0.85 Identities = 11/36 (30%), Positives = 18/36 (50%) Frame = +3 Query: 171 EYDCAVCLQKCQHPTKLSCGHVFCFLCVRV*LIKAE 278 E C++C++ P L C H FC C+ + +E Sbjct: 12 EVTCSICIEHFNDPRVLPCFHSFCLHCLEELAVHSE 47 >SB_22201| Best HMM Match : zf-C3HC4 (HMM E-Value=8.1e-10) Length = 604 Score = 31.1 bits (67), Expect = 0.85 Identities = 10/25 (40%), Positives = 17/25 (68%) Frame = +3 Query: 180 CAVCLQKCQHPTKLSCGHVFCFLCV 254 C++CL++ Q P L+C H +C C+ Sbjct: 17 CSLCLEQYQDPRVLACLHTYCRHCL 41 >SB_7188| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1094 Score = 31.1 bits (67), Expect = 0.85 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +3 Query: 171 EYDCAVCLQKCQHPTKLSCGHVFCFLC 251 E+ C+ C + HP CGHV C C Sbjct: 15 EFLCSYCRKVYLHPLVTGCGHVLCTKC 41 >SB_2107| Best HMM Match : zf-B_box (HMM E-Value=3.9e-08) Length = 599 Score = 31.1 bits (67), Expect = 0.85 Identities = 10/25 (40%), Positives = 17/25 (68%) Frame = +3 Query: 180 CAVCLQKCQHPTKLSCGHVFCFLCV 254 C++CL++ Q P L+C H +C C+ Sbjct: 26 CSLCLEQYQDPRVLACLHTYCRHCL 50 >SB_27080| Best HMM Match : zf-C3HC4 (HMM E-Value=8.1e-10) Length = 462 Score = 31.1 bits (67), Expect = 0.85 Identities = 10/25 (40%), Positives = 17/25 (68%) Frame = +3 Query: 180 CAVCLQKCQHPTKLSCGHVFCFLCV 254 C++CL++ Q P L+C H +C C+ Sbjct: 17 CSLCLEQYQDPRVLACLHTYCRHCL 41 >SB_11151| Best HMM Match : Neur_chan_memb (HMM E-Value=3.6e-10) Length = 434 Score = 31.1 bits (67), Expect = 0.85 Identities = 12/27 (44%), Positives = 19/27 (70%) Frame = -2 Query: 237 KHDRRIVLLDVDIFASKQHNHIPYYVR 157 KH +RI+++D+DIFA K H Y++ Sbjct: 20 KHIKRIIVVDLDIFADKSPLHSSQYMK 46 >SB_40057| Best HMM Match : zf-B_box (HMM E-Value=1.4e-08) Length = 584 Score = 30.7 bits (66), Expect = 1.1 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +3 Query: 180 CAVCLQKCQHPTKLSCGHVFCFLCV 254 C +CL++ Q P L+C H +C C+ Sbjct: 16 CCLCLEQYQDPRVLACLHTYCRHCL 40 >SB_31692| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 598 Score = 30.7 bits (66), Expect = 1.1 Identities = 11/30 (36%), Positives = 18/30 (60%), Gaps = 1/30 (3%) Frame = +3 Query: 171 EYDCAVCLQKCQHPTKLS-CGHVFCFLCVR 257 EY+C +C + P ++ CGH FC C++ Sbjct: 23 EYECPICQLAFRDPIQIEECGHRFCQSCLQ 52 >SB_22639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 956 Score = 30.7 bits (66), Expect = 1.1 Identities = 13/40 (32%), Positives = 21/40 (52%) Frame = +3 Query: 135 LKHAVLIFSHNMEYDCAVCLQKCQHPTKLSCGHVFCFLCV 254 L+ A ++ S E +C++C + P L C H FC C+ Sbjct: 83 LQMASILDSLRQEAECSLCHKTPSEPKILKCFHTFCNECL 122 >SB_20056| Best HMM Match : zf-C3HC4 (HMM E-Value=9e-11) Length = 471 Score = 30.7 bits (66), Expect = 1.1 Identities = 8/28 (28%), Positives = 15/28 (53%) Frame = +3 Query: 174 YDCAVCLQKCQHPTKLSCGHVFCFLCVR 257 ++C +C P + CGH +C C++ Sbjct: 20 FECGLCGDFYVDPVTILCGHTYCLACIK 47 Score = 28.7 bits (61), Expect = 4.5 Identities = 9/28 (32%), Positives = 14/28 (50%) Frame = +3 Query: 171 EYDCAVCLQKCQHPTKLSCGHVFCFLCV 254 +++C +C P CGH FC C+ Sbjct: 327 DFECKLCFNLLLEPVTSLCGHSFCRDCL 354 >SB_13725| Best HMM Match : zf-B_box (HMM E-Value=6e-14) Length = 594 Score = 30.7 bits (66), Expect = 1.1 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +3 Query: 180 CAVCLQKCQHPTKLSCGHVFCFLCV 254 C +CL++ Q P L+C H +C C+ Sbjct: 16 CCLCLEQYQDPRVLACLHTYCRHCL 40 >SB_35560| Best HMM Match : zf-B_box (HMM E-Value=1e-20) Length = 470 Score = 30.7 bits (66), Expect = 1.1 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = +3 Query: 171 EYDCAVCLQKCQHPTKLSCGHVFCFLCV 254 E CA+C++ P L C H FC C+ Sbjct: 12 EVTCAICIEHFTDPRLLPCLHTFCRHCL 39 >SB_4488| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 645 Score = 30.7 bits (66), Expect = 1.1 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = +3 Query: 180 CAVCLQKCQHPTKLSCGHVFCFLCV 254 C +C + + P SCGH FC C+ Sbjct: 194 CPLCRRVFKDPVITSCGHTFCQACI 218 >SB_33568| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1555 Score = 30.3 bits (65), Expect = 1.5 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = +3 Query: 180 CAVCLQKCQHPTKLSCGHVFCFLCVR 257 CA+C + P SCGH +C C++ Sbjct: 30 CAICHIVVKDPILTSCGHSYCKCCIQ 55 >SB_18762| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 261 Score = 30.3 bits (65), Expect = 1.5 Identities = 11/29 (37%), Positives = 14/29 (48%) Frame = +3 Query: 165 NMEYDCAVCLQKCQHPTKLSCGHVFCFLC 251 N E+ CA+CL + P C H C C Sbjct: 20 NEEFHCAICLDVLEKPLSSKCQHSCCSDC 48 >SB_46701| Best HMM Match : zf-B_box (HMM E-Value=1.4e-17) Length = 442 Score = 29.9 bits (64), Expect = 2.0 Identities = 11/36 (30%), Positives = 18/36 (50%) Frame = +3 Query: 171 EYDCAVCLQKCQHPTKLSCGHVFCFLCVRV*LIKAE 278 E C++C++ P L C H FC C+ + +E Sbjct: 12 EVTCSICIEHFNDPRVLPCFHSFCRHCLEELAVHSE 47 >SB_21628| Best HMM Match : zf-B_box (HMM E-Value=1.4e-17) Length = 291 Score = 29.9 bits (64), Expect = 2.0 Identities = 11/36 (30%), Positives = 18/36 (50%) Frame = +3 Query: 171 EYDCAVCLQKCQHPTKLSCGHVFCFLCVRV*LIKAE 278 E C++C++ P L C H FC C+ + +E Sbjct: 12 EVTCSICIEHFNDPRVLPCFHSFCRHCLEELAVHSE 47 >SB_6628| Best HMM Match : zf-C3HC4 (HMM E-Value=1e-09) Length = 89 Score = 29.9 bits (64), Expect = 2.0 Identities = 11/36 (30%), Positives = 18/36 (50%) Frame = +3 Query: 171 EYDCAVCLQKCQHPTKLSCGHVFCFLCVRV*LIKAE 278 E C++C++ P L C H FC C+ + +E Sbjct: 12 EVTCSICIEHFNDPRVLPCFHSFCRHCLEELAVHSE 47 >SB_51226| Best HMM Match : zf-C3HC4 (HMM E-Value=1e-09) Length = 82 Score = 29.9 bits (64), Expect = 2.0 Identities = 11/36 (30%), Positives = 18/36 (50%) Frame = +3 Query: 171 EYDCAVCLQKCQHPTKLSCGHVFCFLCVRV*LIKAE 278 E C++C++ P L C H FC C+ + +E Sbjct: 12 EVTCSICIEHFNDPRVLPCFHSFCRHCLEELAVHSE 47 >SB_47995| Best HMM Match : zf-C3HC4 (HMM E-Value=1e-09) Length = 745 Score = 29.9 bits (64), Expect = 2.0 Identities = 11/36 (30%), Positives = 18/36 (50%) Frame = +3 Query: 171 EYDCAVCLQKCQHPTKLSCGHVFCFLCVRV*LIKAE 278 E C++C++ P L C H FC C+ + +E Sbjct: 12 EVTCSICIEHFNDPRVLPCFHSFCRHCLEELAVHSE 47 >SB_43880| Best HMM Match : zf-B_box (HMM E-Value=5.1e-15) Length = 405 Score = 29.9 bits (64), Expect = 2.0 Identities = 11/36 (30%), Positives = 18/36 (50%) Frame = +3 Query: 171 EYDCAVCLQKCQHPTKLSCGHVFCFLCVRV*LIKAE 278 E C++C++ P L C H FC C+ + +E Sbjct: 11 EVTCSICIEHFNDPRVLPCFHSFCRHCLEELAVHSE 46 >SB_6802| Best HMM Match : zf-B_box (HMM E-Value=5e-18) Length = 316 Score = 29.9 bits (64), Expect = 2.0 Identities = 11/36 (30%), Positives = 18/36 (50%) Frame = +3 Query: 171 EYDCAVCLQKCQHPTKLSCGHVFCFLCVRV*LIKAE 278 E C++C++ P L C H FC C+ + +E Sbjct: 12 EVTCSICIEHLNDPRVLPCLHSFCRHCLEELAVHSE 47 >SB_52986| Best HMM Match : zf-C2H2 (HMM E-Value=0.0042) Length = 623 Score = 29.5 bits (63), Expect = 2.6 Identities = 12/35 (34%), Positives = 19/35 (54%), Gaps = 1/35 (2%) Frame = +3 Query: 180 CAVCLQKCQHPTKLSCGHVFCF-LCVRV*LIKAEN 281 C VC ++ + C H C+ CVR+ ++K EN Sbjct: 14 CVVCCEEIEFSAVGKCDHPVCYKCCVRMRVLKQEN 48 >SB_37011| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1829 Score = 29.5 bits (63), Expect = 2.6 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +3 Query: 180 CAVCLQKCQHPTKLSCGHVFCFLCV 254 C++CL + Q P L+C H +C C+ Sbjct: 17 CSLCLGQYQDPRVLACLHTYCRHCL 41 >SB_28248| Best HMM Match : zf-C3HC4 (HMM E-Value=4e-10) Length = 119 Score = 29.5 bits (63), Expect = 2.6 Identities = 11/36 (30%), Positives = 18/36 (50%) Frame = +3 Query: 171 EYDCAVCLQKCQHPTKLSCGHVFCFLCVRV*LIKAE 278 E C++C++ P L C H FC C+ + +E Sbjct: 12 EVTCSICIEHFNDPRVLPCLHSFCRHCLEELAVHSE 47 >SB_26592| Best HMM Match : zf-B_box (HMM E-Value=1.3e-18) Length = 355 Score = 29.5 bits (63), Expect = 2.6 Identities = 11/36 (30%), Positives = 18/36 (50%) Frame = +3 Query: 171 EYDCAVCLQKCQHPTKLSCGHVFCFLCVRV*LIKAE 278 E C++C++ P L C H FC C+ + +E Sbjct: 12 EVRCSICIEHFNDPRVLPCFHSFCRHCLEELAVHSE 47 >SB_53640| Best HMM Match : zf-C3HC4 (HMM E-Value=4e-10) Length = 62 Score = 29.5 bits (63), Expect = 2.6 Identities = 11/36 (30%), Positives = 18/36 (50%) Frame = +3 Query: 171 EYDCAVCLQKCQHPTKLSCGHVFCFLCVRV*LIKAE 278 E C++C++ P L C H FC C+ + +E Sbjct: 12 EVTCSICIEHFNDPRVLPCLHSFCRHCLEELAVHSE 47 >SB_48401| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 694 Score = 29.5 bits (63), Expect = 2.6 Identities = 12/35 (34%), Positives = 19/35 (54%), Gaps = 1/35 (2%) Frame = +3 Query: 180 CAVCLQKCQHPTKLSCGHVFCF-LCVRV*LIKAEN 281 C VC ++ + C H C+ CVR+ ++K EN Sbjct: 14 CVVCCEEIEFSAVGKCDHPVCYKCCVRMRVLKQEN 48 >SB_48027| Best HMM Match : zf-C3HC4 (HMM E-Value=4e-10) Length = 62 Score = 29.5 bits (63), Expect = 2.6 Identities = 11/36 (30%), Positives = 18/36 (50%) Frame = +3 Query: 171 EYDCAVCLQKCQHPTKLSCGHVFCFLCVRV*LIKAE 278 E C++C++ P L C H FC C+ + +E Sbjct: 12 EVTCSICIEHFNDPRVLPCLHSFCRHCLEELAVHSE 47 >SB_41431| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 667 Score = 29.5 bits (63), Expect = 2.6 Identities = 11/36 (30%), Positives = 18/36 (50%) Frame = +3 Query: 171 EYDCAVCLQKCQHPTKLSCGHVFCFLCVRV*LIKAE 278 E C++C++ P L C H FC C+ + +E Sbjct: 17 EVTCSICIEHFDDPRVLPCLHSFCRHCLEELAVHSE 52 >SB_37498| Best HMM Match : MATH (HMM E-Value=1.8e-28) Length = 562 Score = 29.5 bits (63), Expect = 2.6 Identities = 11/36 (30%), Positives = 16/36 (44%) Frame = +3 Query: 174 YDCAVCLQKCQHPTKLSCGHVFCFLCVRV*LIKAEN 281 + C +C Q P + +CGH C C + L N Sbjct: 32 FRCTICKHVLQEPLQTTCGHRICESCFELSLRHLNN 67 >SB_22421| Best HMM Match : zf-B_box (HMM E-Value=4e-17) Length = 463 Score = 29.5 bits (63), Expect = 2.6 Identities = 11/36 (30%), Positives = 18/36 (50%) Frame = +3 Query: 171 EYDCAVCLQKCQHPTKLSCGHVFCFLCVRV*LIKAE 278 E C++C++ P L C H FC C+ + +E Sbjct: 12 EVTCSICIEHFNDPRVLPCLHSFCRHCLEELAVHSE 47 >SB_11572| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 888 Score = 29.5 bits (63), Expect = 2.6 Identities = 11/36 (30%), Positives = 18/36 (50%) Frame = +3 Query: 171 EYDCAVCLQKCQHPTKLSCGHVFCFLCVRV*LIKAE 278 E C++C++ P L C H FC C+ + +E Sbjct: 11 EVTCSICIEHFNDPRVLPCLHSFCRHCLEELAVHSE 46 >SB_14352| Best HMM Match : NHL (HMM E-Value=2.8026e-45) Length = 784 Score = 29.1 bits (62), Expect = 3.4 Identities = 11/25 (44%), Positives = 13/25 (52%) Frame = +3 Query: 180 CAVCLQKCQHPTKLSCGHVFCFLCV 254 C VC Q+ P L C H FC C+ Sbjct: 62 CRVCNQRFNKPKLLHCLHSFCQSCI 86 >SB_16517| Best HMM Match : zf-C3HC4 (HMM E-Value=1e-07) Length = 306 Score = 29.1 bits (62), Expect = 3.4 Identities = 12/41 (29%), Positives = 19/41 (46%), Gaps = 2/41 (4%) Frame = +3 Query: 180 CAVCLQKCQHPTKLSCGHVFCFLCVRV*LIK--AENVQCAA 296 C +C + + CGH FC +C+ + EN +C A Sbjct: 18 CGICAEVLERAVLTPCGHSFCGVCLETWMNAKLEENEKCPA 58 >SB_5620| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 937 Score = 29.1 bits (62), Expect = 3.4 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = +3 Query: 180 CAVCLQKCQHPTKLSCGHVFCFLCV 254 C +CL + + P LSC H C C+ Sbjct: 21 CPICLDEFKEPKTLSCMHDLCRKCL 45 >SB_4090| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2342 Score = 29.1 bits (62), Expect = 3.4 Identities = 11/36 (30%), Positives = 18/36 (50%) Frame = +3 Query: 171 EYDCAVCLQKCQHPTKLSCGHVFCFLCVRV*LIKAE 278 E C++C++ P L C H FC C+ + +E Sbjct: 12 EVTCSLCIEHFNDPRVLPCFHSFCRHCLEELAVHSE 47 >SB_57762| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 639 Score = 28.7 bits (61), Expect = 4.5 Identities = 11/36 (30%), Positives = 18/36 (50%) Frame = +3 Query: 171 EYDCAVCLQKCQHPTKLSCGHVFCFLCVRV*LIKAE 278 E C++C++ P L C H FC C+ + +E Sbjct: 12 EVTCSLCIEHFNDPRVLPCLHSFCRHCLEELAVHSE 47 >SB_44886| Best HMM Match : zf-C3HC4 (HMM E-Value=1.3e-06) Length = 406 Score = 28.7 bits (61), Expect = 4.5 Identities = 10/36 (27%), Positives = 16/36 (44%) Frame = +3 Query: 150 LIFSHNMEYDCAVCLQKCQHPTKLSCGHVFCFLCVR 257 L+ H C C + + C HVFC+ C++ Sbjct: 344 LVLFHQARLTCPCCNTRKKDAILTKCFHVFCYECLK 379 >SB_37786| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 434 Score = 28.7 bits (61), Expect = 4.5 Identities = 10/27 (37%), Positives = 13/27 (48%) Frame = +3 Query: 171 EYDCAVCLQKCQHPTKLSCGHVFCFLC 251 E+ CA+CL + P C H C C Sbjct: 169 EFHCAICLDVLEKPLSSKCQHSCCSDC 195 >SB_36597| Best HMM Match : zf-C3HC4 (HMM E-Value=2.9e-07) Length = 346 Score = 28.7 bits (61), Expect = 4.5 Identities = 11/37 (29%), Positives = 17/37 (45%) Frame = +3 Query: 180 CAVCLQKCQHPTKLSCGHVFCFLCVRV*LIKAENVQC 290 C +C+ ++ CGH FC C+ L + E C Sbjct: 18 CNICVGVLENAITTICGHSFCESCLETWLSRPEVQSC 54 >SB_18515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 391 Score = 28.7 bits (61), Expect = 4.5 Identities = 11/36 (30%), Positives = 18/36 (50%) Frame = +3 Query: 171 EYDCAVCLQKCQHPTKLSCGHVFCFLCVRV*LIKAE 278 E C++C++ P L C H FC C+ + +E Sbjct: 12 EVTCSLCIEHFNDPRVLPCLHSFCRHCLEELAVHSE 47 >SB_944| Best HMM Match : zf-B_box (HMM E-Value=6.7e-15) Length = 629 Score = 28.7 bits (61), Expect = 4.5 Identities = 11/36 (30%), Positives = 18/36 (50%) Frame = +3 Query: 171 EYDCAVCLQKCQHPTKLSCGHVFCFLCVRV*LIKAE 278 E C++C++ P L C H FC C+ + +E Sbjct: 132 EVTCSLCIEHFNDPRVLPCLHSFCRHCLEELAVHSE 167 >SB_50665| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 625 Score = 28.7 bits (61), Expect = 4.5 Identities = 10/27 (37%), Positives = 13/27 (48%) Frame = +3 Query: 171 EYDCAVCLQKCQHPTKLSCGHVFCFLC 251 E+ CA+CL + P C H C C Sbjct: 165 EFHCAICLDVLEKPLSSKCQHSCCSDC 191 >SB_38753| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 797 Score = 28.7 bits (61), Expect = 4.5 Identities = 10/27 (37%), Positives = 13/27 (48%) Frame = +3 Query: 171 EYDCAVCLQKCQHPTKLSCGHVFCFLC 251 E+ CA+CL + P C H C C Sbjct: 73 EFHCAICLDVLEKPLSSKCQHSCCSDC 99 >SB_38368| Best HMM Match : zf-C3HC4 (HMM E-Value=4.4e-15) Length = 846 Score = 28.7 bits (61), Expect = 4.5 Identities = 10/27 (37%), Positives = 13/27 (48%) Frame = +3 Query: 171 EYDCAVCLQKCQHPTKLSCGHVFCFLC 251 E+ CA+CL + P C H C C Sbjct: 313 EFHCAICLDVLEKPLSSKCQHSCCSDC 339 Score = 28.7 bits (61), Expect = 4.5 Identities = 10/27 (37%), Positives = 13/27 (48%) Frame = +3 Query: 171 EYDCAVCLQKCQHPTKLSCGHVFCFLC 251 E+ CA+CL + P C H C C Sbjct: 639 EFHCAICLDVLEKPLSSKCQHSCCSDC 665 >SB_23299| Best HMM Match : zf-C3HC4 (HMM E-Value=5.9e-06) Length = 418 Score = 28.7 bits (61), Expect = 4.5 Identities = 10/27 (37%), Positives = 13/27 (48%) Frame = +3 Query: 171 EYDCAVCLQKCQHPTKLSCGHVFCFLC 251 E+ CA+CL + P C H C C Sbjct: 171 EFHCAICLDVLEKPLSSKCQHSCCSDC 197 >SB_22842| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 757 Score = 28.7 bits (61), Expect = 4.5 Identities = 10/27 (37%), Positives = 13/27 (48%) Frame = +3 Query: 171 EYDCAVCLQKCQHPTKLSCGHVFCFLC 251 E+ CA+CL + P C H C C Sbjct: 316 EFHCAICLDVLEKPLSSKCQHSCCSDC 342 >SB_25899| Best HMM Match : Ribonuc_2-5A (HMM E-Value=0) Length = 603 Score = 28.3 bits (60), Expect = 6.0 Identities = 19/48 (39%), Positives = 26/48 (54%), Gaps = 1/48 (2%) Frame = +2 Query: 215 KTILRSCFLFSLCEGVAHQSRKCAMCRTEIPL-DYFENPVLLDKSNLQ 355 K IL CF F+ E HQ R A+ ++ L +Y E+P D+S LQ Sbjct: 242 KRILPECFSFADREEQDHQFRYIALELCDVTLQEYVEDP-RFDRSELQ 288 >SB_24485| Best HMM Match : zf-CCCH (HMM E-Value=3e-09) Length = 321 Score = 28.3 bits (60), Expect = 6.0 Identities = 9/29 (31%), Positives = 15/29 (51%) Frame = +3 Query: 165 NMEYDCAVCLQKCQHPTKLSCGHVFCFLC 251 N+ + C +C + ++P C H FC C Sbjct: 240 NLPFACIMCRKTFKNPVVTKCLHYFCEAC 268 >SB_5773| Best HMM Match : HA2 (HMM E-Value=3e-16) Length = 2352 Score = 28.3 bits (60), Expect = 6.0 Identities = 11/26 (42%), Positives = 16/26 (61%), Gaps = 1/26 (3%) Frame = +3 Query: 180 CAVCLQKCQHPTKLS-CGHVFCFLCV 254 C C + +P +L+ CGHV+C CV Sbjct: 1951 CPACFCEVDNPYQLATCGHVYCRGCV 1976 >SB_58031| Best HMM Match : DB (HMM E-Value=1.5) Length = 297 Score = 27.9 bits (59), Expect = 7.9 Identities = 20/77 (25%), Positives = 38/77 (49%), Gaps = 1/77 (1%) Frame = +2 Query: 131 CTQACCINFLT*YGI*LCCLLAKMSTSNKTILRSCFLFSLCEGVAHQSRKCAMCRTEIPL 310 C Q C I + G C L +++T+NK+ + + + C+ ++H + C+T+ Sbjct: 35 CLQHCDIPGTSINGF---CKLKRIATTNKSDADNSYNKACCQDLSHLCQDIDCCQTD--- 88 Query: 311 DYFENPVLLD-KSNLQY 358 D F+ + D S +QY Sbjct: 89 DNFDGTLFKDLPSAIQY 105 >SB_16508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 514 Score = 27.9 bits (59), Expect = 7.9 Identities = 9/34 (26%), Positives = 18/34 (52%) Frame = +3 Query: 153 IFSHNMEYDCAVCLQKCQHPTKLSCGHVFCFLCV 254 ++ + +C++C + + P L C H FC C+ Sbjct: 11 VYELSKHLNCSLCHRLIRGPKLLPCLHSFCLACL 44 >SB_10749| Best HMM Match : DB (HMM E-Value=1.5) Length = 616 Score = 27.9 bits (59), Expect = 7.9 Identities = 20/77 (25%), Positives = 38/77 (49%), Gaps = 1/77 (1%) Frame = +2 Query: 131 CTQACCINFLT*YGI*LCCLLAKMSTSNKTILRSCFLFSLCEGVAHQSRKCAMCRTEIPL 310 C Q C I + G C L +++T+NK+ + + + C+ ++H + C+T+ Sbjct: 249 CLQHCDIPGTSINGF---CKLKRIATTNKSDADNSYNKACCQDLSHLCQDIDCCQTD--- 302 Query: 311 DYFENPVLLD-KSNLQY 358 D F+ + D S +QY Sbjct: 303 DNFDGTLFKDLPSAIQY 319 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,691,439 Number of Sequences: 59808 Number of extensions: 424917 Number of successful extensions: 1197 Number of sequences better than 10.0: 73 Number of HSP's better than 10.0 without gapping: 1110 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1196 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1733301648 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -