BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS01000 (676 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY280848-1|AAQ16312.1| 632|Apis mellifera hyperpolarization-act... 22 6.1 DQ011227-1|AAY63896.1| 484|Apis mellifera Amt-1-like protein pr... 21 8.1 AY898652-1|AAX83121.1| 349|Apis mellifera AKH receptor protein. 21 8.1 AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor ... 21 8.1 AB095514-1|BAC76336.1| 72|Apis mellifera ecdyson receptor prot... 21 8.1 >AY280848-1|AAQ16312.1| 632|Apis mellifera hyperpolarization-activated ion channel protein. Length = 632 Score = 21.8 bits (44), Expect = 6.1 Identities = 12/44 (27%), Positives = 22/44 (50%) Frame = -3 Query: 443 ELYAHHISTNHFFLHNTIGILPLHQHWQHTED*TCPIEQGFQSS 312 E+Y ++++ + N I ++ L HW P+ QGF S+ Sbjct: 234 EVYFLNMASVFMRIFNLICMMLLIGHWSGCLQFLVPMLQGFPSN 277 >DQ011227-1|AAY63896.1| 484|Apis mellifera Amt-1-like protein protein. Length = 484 Score = 21.4 bits (43), Expect = 8.1 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 88 KYVCSFVVFHNFLMFQINFGWIW 20 K C F F N +++ + GWIW Sbjct: 146 KAYCLFS-FLNTIVYCVPAGWIW 167 >AY898652-1|AAX83121.1| 349|Apis mellifera AKH receptor protein. Length = 349 Score = 21.4 bits (43), Expect = 8.1 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = +2 Query: 392 WYYEGRNGWWKYDER 436 WY+ RN +K D+R Sbjct: 282 WYWIDRNSAYKIDQR 296 >AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor A isoform protein. Length = 567 Score = 21.4 bits (43), Expect = 8.1 Identities = 9/33 (27%), Positives = 19/33 (57%) Frame = +2 Query: 569 GAKGYPTVTCQRNSRYKNQY*SKCQLK*KMKLK 667 G KG+ + +N+ Y+ +Y + C++ M+ K Sbjct: 206 GCKGFFRRSITKNAVYQCKYGNNCEIDMYMRRK 238 >AB095514-1|BAC76336.1| 72|Apis mellifera ecdyson receptor protein. Length = 72 Score = 21.4 bits (43), Expect = 8.1 Identities = 9/33 (27%), Positives = 19/33 (57%) Frame = +2 Query: 569 GAKGYPTVTCQRNSRYKNQY*SKCQLK*KMKLK 667 G KG+ + +N+ Y+ +Y + C++ M+ K Sbjct: 3 GCKGFFRRSITKNAVYQCKYGNNCEIDMYMRRK 35 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 191,746 Number of Sequences: 438 Number of extensions: 3977 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20464920 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -