BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00999 (679 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 23 3.5 EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. 22 4.7 AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. 22 4.7 AB208106-1|BAE72138.1| 111|Apis mellifera Broad complex zinc fi... 22 4.7 Z26318-1|CAA81227.1| 544|Apis mellifera royal jelly protein RJP... 22 6.2 AY263366-1|AAO92605.1| 139|Apis mellifera octopamine receptor p... 21 8.2 AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor p... 21 8.2 AF205594-1|AAQ13840.1| 156|Apis mellifera acid phosphatase prec... 21 8.2 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 22.6 bits (46), Expect = 3.5 Identities = 11/30 (36%), Positives = 14/30 (46%) Frame = -2 Query: 222 LLIVPFDLGLPTPFKPSVGRSGFIECPDLL 133 L PF+ P PF PS +G P +L Sbjct: 1156 LPFTPFNFWNPPPFMPSPFMAGAPNVPTIL 1185 >EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. Length = 683 Score = 22.2 bits (45), Expect = 4.7 Identities = 8/10 (80%), Positives = 9/10 (90%) Frame = +3 Query: 48 FFFHKRVLNR 77 FF HK+VLNR Sbjct: 259 FFLHKQVLNR 268 >AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. Length = 683 Score = 22.2 bits (45), Expect = 4.7 Identities = 8/10 (80%), Positives = 9/10 (90%) Frame = +3 Query: 48 FFFHKRVLNR 77 FF HK+VLNR Sbjct: 259 FFLHKQVLNR 268 >AB208106-1|BAE72138.1| 111|Apis mellifera Broad complex zinc finger domain-Z1 isoform protein. Length = 111 Score = 22.2 bits (45), Expect = 4.7 Identities = 10/29 (34%), Positives = 17/29 (58%) Frame = +2 Query: 323 ALNQTKNGLEIQELYHRMHCKNFKRSLEL 409 +LN +N + +YHR H KN ++ E+ Sbjct: 44 SLNSLRNH---KSIYHRQHSKNEQQRKEM 69 >Z26318-1|CAA81227.1| 544|Apis mellifera royal jelly protein RJP57-1 protein. Length = 544 Score = 21.8 bits (44), Expect = 6.2 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = +1 Query: 202 IKRNN*ETTDVPKL*GKKDKTGKILTPAP 288 I+RNN + + + KK K G +L P P Sbjct: 86 IERNNGVPSSLNVVTNKKGKGGPLLRPYP 114 >AY263366-1|AAO92605.1| 139|Apis mellifera octopamine receptor protein. Length = 139 Score = 21.4 bits (43), Expect = 8.2 Identities = 12/43 (27%), Positives = 19/43 (44%) Frame = -2 Query: 642 CQYRLVSSYFSELSSTALCKSFRSLNLNSLFFSAF*DQMSYQN 514 C Y L S F + +CK F N+L + Q++ +N Sbjct: 60 CIYALFSKDFRFAFKSIICKCFCKRRTNTLRRGSDGSQLAMRN 102 >AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor protein. Length = 587 Score = 21.4 bits (43), Expect = 8.2 Identities = 12/43 (27%), Positives = 19/43 (44%) Frame = -2 Query: 642 CQYRLVSSYFSELSSTALCKSFRSLNLNSLFFSAF*DQMSYQN 514 C Y L S F + +CK F N+L + Q++ +N Sbjct: 508 CIYALFSKDFRFAFKSIICKCFCKRRTNTLRRGSDGSQLAMRN 550 >AF205594-1|AAQ13840.1| 156|Apis mellifera acid phosphatase precursor protein. Length = 156 Score = 21.4 bits (43), Expect = 8.2 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = -2 Query: 585 KSFRSLNLNSLFFS 544 KSF LN N LFF+ Sbjct: 142 KSFSLLNFNLLFFN 155 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 186,125 Number of Sequences: 438 Number of extensions: 4325 Number of successful extensions: 9 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20586735 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -