Bombyx BLAST Result against uniref50

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS00998
         (657 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_A7AT47 Cluster: Putative uncharacterized protein; n=1; ...    33   6.0  

>UniRef50_A7AT47 Cluster: Putative uncharacterized protein; n=1;
           Babesia bovis|Rep: Putative uncharacterized protein -
           Babesia bovis
          Length = 951

 Score = 33.1 bits (72), Expect = 6.0
 Identities = 18/57 (31%), Positives = 31/57 (54%)
 Frame = -1

Query: 345 IRFDMLKHNYKTLRQKTNNSHECSLHVGIEL*PSFQQSMVLTTVPSSQSTKKTRTNT 175
           IR + L+ +YKTL +    + E SL   +E+     ++MVL  +   Q+ ++T  NT
Sbjct: 478 IRHETLETSYKTLCENVKLAEEASLKTALEIKKLQTRNMVLEELIQIQAMEQTELNT 534


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 542,122,352
Number of Sequences: 1657284
Number of extensions: 9320701
Number of successful extensions: 15343
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 14972
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 15343
length of database: 575,637,011
effective HSP length: 98
effective length of database: 413,223,179
effective search space used: 49586781480
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)