BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00998 (657 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_01_0540 - 4055635-4055743,4055829-4055981,4056037-4056104,405... 30 1.9 01_03_0093 - 12422558-12422607,12422679-12422935,12423565-124239... 28 7.5 >03_01_0540 - 4055635-4055743,4055829-4055981,4056037-4056104, 4056486-4056580,4057180-4057241,4057371-4057410, 4058124-4059141,4059231-4059611,4059873-4059880, 4061005-4061067,4061416-4061719 Length = 766 Score = 29.9 bits (64), Expect = 1.9 Identities = 17/51 (33%), Positives = 26/51 (50%) Frame = -1 Query: 408 NRLQTRTL*AVRTRDH*HSLSIRFDMLKHNYKTLRQKTNNSHECSLHVGIE 256 N LQ R L A+RT+D + L + + N++ R +S SLH I+ Sbjct: 606 NHLQDRVLEALRTQDSLNELDDCSEFERSNFEEYRSLVQSSPVSSLHSNIQ 656 >01_03_0093 - 12422558-12422607,12422679-12422935,12423565-12423932, 12423939-12424800,12425247-12425464 Length = 584 Score = 27.9 bits (59), Expect = 7.5 Identities = 12/24 (50%), Positives = 15/24 (62%) Frame = -2 Query: 578 NKKFKITVYNIKSLFLIRVYNSKL 507 NK+ I YN KS +I VY+S L Sbjct: 556 NKRVVIATYNFKSAIIISVYSSTL 579 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,846,235 Number of Sequences: 37544 Number of extensions: 232859 Number of successful extensions: 356 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 353 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 356 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1644004708 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -