BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00998 (657 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_47477| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.9 SB_19564| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.9 >SB_47477| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 632 Score = 29.9 bits (64), Expect = 1.9 Identities = 17/48 (35%), Positives = 25/48 (52%), Gaps = 1/48 (2%) Frame = -1 Query: 420 TPSLNRLQTRT-L*AVRTRDH*HSLSIRFDMLKHNYKTLRQKTNNSHE 280 T R +T T L +RTRD S + R D+ KHN + + N+S + Sbjct: 281 TTHSKRAETVTSLVGLRTRDDIRSFTFRKDICKHNIRPKHHRANSSEK 328 >SB_19564| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 790 Score = 29.9 bits (64), Expect = 1.9 Identities = 15/44 (34%), Positives = 21/44 (47%) Frame = -1 Query: 306 RQKTNNSHECSLHVGIEL*PSFQQSMVLTTVPSSQSTKKTRTNT 175 R +TN++ S + PSF + T P S+S KKT T Sbjct: 224 RPRTNSNSSVSSNSSASSIPSFNPNETFTITPQSESIKKTSKRT 267 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,192,640 Number of Sequences: 59808 Number of extensions: 308281 Number of successful extensions: 556 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 495 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 556 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1681430875 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -