BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00998 (657 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U97407-4|AAB52482.3| 1272|Caenorhabditis elegans P-glycoprotein ... 32 0.31 EF205592-1|ABM92304.1| 1272|Caenorhabditis elegans ABC transport... 32 0.31 >U97407-4|AAB52482.3| 1272|Caenorhabditis elegans P-glycoprotein related protein 2 protein. Length = 1272 Score = 32.3 bits (70), Expect = 0.31 Identities = 18/44 (40%), Positives = 28/44 (63%) Frame = -2 Query: 536 FLIRVYNSKLS*AKLLFHFYKHPSGIDSIK*INNVRPITHHHSI 405 F+ V ++L+ A LLF+ +HP+ IDS+ V+PIT + SI Sbjct: 988 FIPDVVKARLA-ASLLFYLIEHPTPIDSLSDSGIVKPITGNISI 1030 >EF205592-1|ABM92304.1| 1272|Caenorhabditis elegans ABC transporter PGP-2 protein. Length = 1272 Score = 32.3 bits (70), Expect = 0.31 Identities = 18/44 (40%), Positives = 28/44 (63%) Frame = -2 Query: 536 FLIRVYNSKLS*AKLLFHFYKHPSGIDSIK*INNVRPITHHHSI 405 F+ V ++L+ A LLF+ +HP+ IDS+ V+PIT + SI Sbjct: 988 FIPDVVKARLA-ASLLFYLIEHPTPIDSLSDSGIVKPITGNISI 1030 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,981,375 Number of Sequences: 27780 Number of extensions: 238578 Number of successful extensions: 447 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 437 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 447 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1465835342 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -