BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00997 (713 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY146725-1|AAO12085.1| 155|Anopheles gambiae odorant-binding pr... 27 0.77 U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse tra... 26 1.4 AY146724-1|AAO12084.1| 151|Anopheles gambiae odorant-binding pr... 26 1.4 AF437889-1|AAL84184.1| 155|Anopheles gambiae odorant binding pr... 26 1.4 AB090815-1|BAC57905.1| 492|Anopheles gambiae gag-like protein p... 25 2.4 M93691-2|AAA29365.1| 1222|Anopheles gambiae protein ( Anopheles ... 25 3.1 EF990671-1|ABS30732.1| 1256|Anopheles gambiae voltage-gated calc... 24 4.1 DQ370037-1|ABD18598.1| 121|Anopheles gambiae putative TIL domai... 24 4.1 DQ986315-1|ABK59975.1| 504|Anopheles gambiae catalase protein. 23 9.5 DQ980210-1|ABL09378.1| 504|Anopheles gambiae catalase protein. 23 9.5 DQ980209-1|ABL09377.1| 504|Anopheles gambiae catalase protein. 23 9.5 DQ980208-1|ABL09376.1| 504|Anopheles gambiae catalase protein. 23 9.5 DQ980207-1|ABL09375.1| 504|Anopheles gambiae catalase protein. 23 9.5 DQ980206-1|ABL09374.1| 504|Anopheles gambiae catalase protein. 23 9.5 DQ980205-1|ABL09373.1| 504|Anopheles gambiae catalase protein. 23 9.5 DQ980204-1|ABL09372.1| 504|Anopheles gambiae catalase protein. 23 9.5 DQ980203-1|ABL09371.1| 504|Anopheles gambiae catalase protein. 23 9.5 DQ980202-1|ABL09370.1| 504|Anopheles gambiae catalase protein. 23 9.5 DQ980201-1|ABL09369.1| 504|Anopheles gambiae catalase protein. 23 9.5 DQ980200-1|ABL09368.1| 504|Anopheles gambiae catalase protein. 23 9.5 DQ980199-1|ABL09367.1| 504|Anopheles gambiae catalase protein. 23 9.5 AY505416-1|AAR90327.1| 485|Anopheles gambiae catalase 1 protein. 23 9.5 AB090824-2|BAC57924.1| 1248|Anopheles gambiae reverse transcript... 23 9.5 >AY146725-1|AAO12085.1| 155|Anopheles gambiae odorant-binding protein AgamOBP6 protein. Length = 155 Score = 26.6 bits (56), Expect = 0.77 Identities = 16/60 (26%), Positives = 28/60 (46%) Frame = +3 Query: 285 PASEYAAKGSAQIKILDDEEIEGMRVACRLGREVLDEAARVCDVGVSTDEIDRVVHEACI 464 PA +A + Q + DE +GMR C ++ +E A G+ D+ + + AC+ Sbjct: 28 PALVHAQQSLTQADM--DEIAKGMRKVCMSRHKISEEMANYPSQGIFPDDQEFKCYVACL 85 >U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse transcriptase protein. Length = 1049 Score = 25.8 bits (54), Expect = 1.4 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +1 Query: 88 FKKSWKTHKIIHSLAKGDNTDAAN 159 F K+W+ ++ KGD TDA N Sbjct: 593 FPKAWRKSWMVPIYKKGDRTDAIN 616 >AY146724-1|AAO12084.1| 151|Anopheles gambiae odorant-binding protein AgamOBP18 protein. Length = 151 Score = 25.8 bits (54), Expect = 1.4 Identities = 12/43 (27%), Positives = 21/43 (48%) Frame = +3 Query: 336 DEEIEGMRVACRLGREVLDEAARVCDVGVSTDEIDRVVHEACI 464 DE +GMR C ++ +E A G+ D+ + + AC+ Sbjct: 39 DEIAKGMRKVCMSRHKISEEMANYPSQGIFPDDKEFKCYVACL 81 >AF437889-1|AAL84184.1| 155|Anopheles gambiae odorant binding protein protein. Length = 155 Score = 25.8 bits (54), Expect = 1.4 Identities = 16/60 (26%), Positives = 28/60 (46%) Frame = +3 Query: 285 PASEYAAKGSAQIKILDDEEIEGMRVACRLGREVLDEAARVCDVGVSTDEIDRVVHEACI 464 PA +A + Q + DE +GMR C ++ +E A G+ D+ + + AC+ Sbjct: 28 PALVHAQQSLTQADM--DEIAKGMRKVCMSRPKISEEMANYPSQGIFPDDKEFKCYVACL 85 >AB090815-1|BAC57905.1| 492|Anopheles gambiae gag-like protein protein. Length = 492 Score = 25.0 bits (52), Expect = 2.4 Identities = 10/44 (22%), Positives = 23/44 (52%) Frame = +1 Query: 193 TGKLRPFPAGPKRTVPPHIGRRITLIIRPGSRLQSMLLKVQLKS 324 TG+ + PA + +PP + +++ PG + + + +LK+ Sbjct: 235 TGEKQVHPASTREALPPRRPKTEAVLVAPGENITHVEILRKLKA 278 >M93691-2|AAA29365.1| 1222|Anopheles gambiae protein ( Anopheles gambiae RT2 retroposon. ). Length = 1222 Score = 24.6 bits (51), Expect = 3.1 Identities = 20/73 (27%), Positives = 26/73 (35%), Gaps = 5/73 (6%) Frame = +1 Query: 1 PGCKSIAQLQCPTCIKLGIKGSFFCNQDC-----FKKSWKTHKIIHSLAKGDNTDAANVE 165 PG I T I L + S F QDC F WK +++ L K + Sbjct: 491 PGLDGIPNAAVKTAIMLFPESSGFLYQDCLNRASFPAQWKRQRLV-LLPKQGKPPGESSS 549 Query: 166 YNPWPSYTFTGKL 204 Y P GK+ Sbjct: 550 YRPLCMLDALGKV 562 >EF990671-1|ABS30732.1| 1256|Anopheles gambiae voltage-gated calcium channel alpha2-delta subunit 1 protein. Length = 1256 Score = 24.2 bits (50), Expect = 4.1 Identities = 13/29 (44%), Positives = 15/29 (51%) Frame = +2 Query: 554 PDLRPLQDGDICNVDVTVYHRGFHGDLNE 640 PDLRPL D D T+ H+ DL E Sbjct: 550 PDLRPLSDND--QYSATLKHKYNSVDLTE 576 >DQ370037-1|ABD18598.1| 121|Anopheles gambiae putative TIL domain polypeptide protein. Length = 121 Score = 24.2 bits (50), Expect = 4.1 Identities = 20/75 (26%), Positives = 33/75 (44%) Frame = +3 Query: 237 AASYRSPDYADHPTGFPASEYAAKGSAQIKILDDEEIEGMRVACRLGREVLDEAARVCDV 416 A++ ++ A+H PA+ + A +EE ++ C REV +E CD Sbjct: 20 ASAEKTDQEAEHGETVPATPEPSTTEAT-----EEESPPPKIECTDPREVYNECGSSCD- 73 Query: 417 GVSTDEIDRVVHEAC 461 + + I R H AC Sbjct: 74 DRTCENIRRGDHLAC 88 >DQ986315-1|ABK59975.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.0 bits (47), Expect = 9.5 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = -3 Query: 294 LKPGTRSDDQRNPATYMRRHSAFW 223 L P +RNPAT+++ FW Sbjct: 156 LFPSFIHTQKRNPATHLKDPDMFW 179 >DQ980210-1|ABL09378.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.0 bits (47), Expect = 9.5 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = -3 Query: 294 LKPGTRSDDQRNPATYMRRHSAFW 223 L P +RNPAT+++ FW Sbjct: 156 LFPSFIHTQKRNPATHLKDPDMFW 179 >DQ980209-1|ABL09377.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.0 bits (47), Expect = 9.5 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = -3 Query: 294 LKPGTRSDDQRNPATYMRRHSAFW 223 L P +RNPAT+++ FW Sbjct: 156 LFPSFIHTQKRNPATHLKDPDMFW 179 >DQ980208-1|ABL09376.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.0 bits (47), Expect = 9.5 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = -3 Query: 294 LKPGTRSDDQRNPATYMRRHSAFW 223 L P +RNPAT+++ FW Sbjct: 156 LFPSFIHTQKRNPATHLKDPDMFW 179 >DQ980207-1|ABL09375.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.0 bits (47), Expect = 9.5 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = -3 Query: 294 LKPGTRSDDQRNPATYMRRHSAFW 223 L P +RNPAT+++ FW Sbjct: 156 LFPSFIHTQKRNPATHLKDPDMFW 179 >DQ980206-1|ABL09374.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.0 bits (47), Expect = 9.5 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = -3 Query: 294 LKPGTRSDDQRNPATYMRRHSAFW 223 L P +RNPAT+++ FW Sbjct: 156 LFPSFIHTQKRNPATHLKDPDMFW 179 >DQ980205-1|ABL09373.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.0 bits (47), Expect = 9.5 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = -3 Query: 294 LKPGTRSDDQRNPATYMRRHSAFW 223 L P +RNPAT+++ FW Sbjct: 156 LFPSFIHTQKRNPATHLKDPDMFW 179 >DQ980204-1|ABL09372.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.0 bits (47), Expect = 9.5 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = -3 Query: 294 LKPGTRSDDQRNPATYMRRHSAFW 223 L P +RNPAT+++ FW Sbjct: 156 LFPSFIHTQKRNPATHLKDPDMFW 179 >DQ980203-1|ABL09371.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.0 bits (47), Expect = 9.5 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = -3 Query: 294 LKPGTRSDDQRNPATYMRRHSAFW 223 L P +RNPAT+++ FW Sbjct: 156 LFPSFIHTQKRNPATHLKDPDMFW 179 >DQ980202-1|ABL09370.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.0 bits (47), Expect = 9.5 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = -3 Query: 294 LKPGTRSDDQRNPATYMRRHSAFW 223 L P +RNPAT+++ FW Sbjct: 156 LFPSFIHTQKRNPATHLKDPDMFW 179 >DQ980201-1|ABL09369.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.0 bits (47), Expect = 9.5 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = -3 Query: 294 LKPGTRSDDQRNPATYMRRHSAFW 223 L P +RNPAT+++ FW Sbjct: 156 LFPSFIHTQKRNPATHLKDPDMFW 179 >DQ980200-1|ABL09368.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.0 bits (47), Expect = 9.5 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = -3 Query: 294 LKPGTRSDDQRNPATYMRRHSAFW 223 L P +RNPAT+++ FW Sbjct: 156 LFPSFIHTQKRNPATHLKDPDMFW 179 >DQ980199-1|ABL09367.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.0 bits (47), Expect = 9.5 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = -3 Query: 294 LKPGTRSDDQRNPATYMRRHSAFW 223 L P +RNPAT+++ FW Sbjct: 156 LFPSFIHTQKRNPATHLKDPDMFW 179 >AY505416-1|AAR90327.1| 485|Anopheles gambiae catalase 1 protein. Length = 485 Score = 23.0 bits (47), Expect = 9.5 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = -3 Query: 294 LKPGTRSDDQRNPATYMRRHSAFW 223 L P +RNPAT+++ FW Sbjct: 140 LFPSFIHTQKRNPATHLKDPDMFW 163 >AB090824-2|BAC57924.1| 1248|Anopheles gambiae reverse transcriptase protein. Length = 1248 Score = 23.0 bits (47), Expect = 9.5 Identities = 6/14 (42%), Positives = 11/14 (78%) Frame = +3 Query: 441 RVVHEACIERECYP 482 R V++ C++R C+P Sbjct: 457 RQVYQECLDRSCFP 470 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 791,778 Number of Sequences: 2352 Number of extensions: 17337 Number of successful extensions: 54 Number of sequences better than 10.0: 23 Number of HSP's better than 10.0 without gapping: 51 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 54 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 73177125 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -