BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00995 (692 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 24 1.6 AB050744-1|BAB17753.1| 238|Apis mellifera period protein protein. 24 1.6 DQ257416-1|ABB81847.1| 552|Apis mellifera yellow-h protein. 23 2.8 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 22 6.4 EF589162-1|ABQ84439.1| 686|Apis mellifera hexamerin 70c protein. 21 8.4 AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. 21 8.4 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 23.8 bits (49), Expect = 1.6 Identities = 14/37 (37%), Positives = 20/37 (54%), Gaps = 1/37 (2%) Frame = +1 Query: 580 QETI-QQVHTTRSHCRCY*SHLQESP*SHPCGSIPQE 687 +ETI V TTR + CY SH+ + G +PQ+ Sbjct: 302 EETIISSVFTTRHNATCYLSHVDPDVVQY-FGYLPQD 337 >AB050744-1|BAB17753.1| 238|Apis mellifera period protein protein. Length = 238 Score = 23.8 bits (49), Expect = 1.6 Identities = 14/37 (37%), Positives = 20/37 (54%), Gaps = 1/37 (2%) Frame = +1 Query: 580 QETI-QQVHTTRSHCRCY*SHLQESP*SHPCGSIPQE 687 +ETI V TTR + CY SH+ + G +PQ+ Sbjct: 8 EETIISSVFTTRHNATCYLSHVDPDVVQY-FGYLPQD 43 >DQ257416-1|ABB81847.1| 552|Apis mellifera yellow-h protein. Length = 552 Score = 23.0 bits (47), Expect = 2.8 Identities = 10/39 (25%), Positives = 22/39 (56%) Frame = +1 Query: 7 TDYYARKRLVVQDKNKYNTPKYRLIVRLSNKDVTCQVAY 123 TD RK ++ +++ K ++ ++V + N+D +AY Sbjct: 288 TDTLIRKYIIPKEQVKEDSLYTNIVVDIRNEDCGSAIAY 326 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 21.8 bits (44), Expect = 6.4 Identities = 11/33 (33%), Positives = 14/33 (42%) Frame = -2 Query: 244 VLIADQLNMLQHNLSDQPSHHNVATHVNKQRTQ 146 V+ + L +S HHNV H RTQ Sbjct: 1661 VISDSESGRLDTEMSTWGYHHNVNKHCTIHRTQ 1693 >EF589162-1|ABQ84439.1| 686|Apis mellifera hexamerin 70c protein. Length = 686 Score = 21.4 bits (43), Expect = 8.4 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = -1 Query: 452 GMRNIEATVNSTLHSSKD 399 GM NIE + +T +SSK+ Sbjct: 193 GMNNIETYIVNTNYSSKN 210 >AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. Length = 898 Score = 21.4 bits (43), Expect = 8.4 Identities = 11/21 (52%), Positives = 12/21 (57%), Gaps = 1/21 (4%) Frame = +2 Query: 617 TADAIE-AIYKKAHEAIRADP 676 T IE A KK H AIR +P Sbjct: 619 TVQVIEDAAQKKKHRAIRPEP 639 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 190,356 Number of Sequences: 438 Number of extensions: 3763 Number of successful extensions: 14 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21195810 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -