BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00993 (652 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB209563-1|BAD92800.1| 393|Homo sapiens Hypothetical protein DK... 31 4.7 >AB209563-1|BAD92800.1| 393|Homo sapiens Hypothetical protein DKFZp686I04222 variant protein. Length = 393 Score = 30.7 bits (66), Expect = 4.7 Identities = 19/51 (37%), Positives = 26/51 (50%), Gaps = 2/51 (3%) Frame = -2 Query: 462 TCKNTIILDVLTHSKHSLAKILSK--GLSISVLFFFSPLSQSKKSGNVYLG 316 +C + I+DVL + + A L K G S FFSP+S S VY+G Sbjct: 16 SCSRSAIMDVLAEANGTFALNLLKTLGKDNSKNVFFSPMSMSCALAMVYMG 66 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 93,425,027 Number of Sequences: 237096 Number of extensions: 2007580 Number of successful extensions: 7524 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 7411 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7524 length of database: 76,859,062 effective HSP length: 87 effective length of database: 56,231,710 effective search space used: 7253890590 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -