BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00993 (652 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z49968-3|CAA90260.1| 189|Caenorhabditis elegans Hypothetical pr... 27 8.7 Z48178-3|CAC42246.1| 1553|Caenorhabditis elegans Hypothetical pr... 27 8.7 Z48178-2|CAA88201.1| 1551|Caenorhabditis elegans Hypothetical pr... 27 8.7 >Z49968-3|CAA90260.1| 189|Caenorhabditis elegans Hypothetical protein M110.3 protein. Length = 189 Score = 27.5 bits (58), Expect = 8.7 Identities = 15/51 (29%), Positives = 25/51 (49%) Frame = +3 Query: 261 CLISNGSYYLIYQNLNMVRPSTHYPTFYFATEERKRIKQKLTIPSKGFWPE 413 C +++G + Y NL + S+ + EER+ IK +L P+ W E Sbjct: 133 CFVASGRRFCYYGNLGLRLASSIFRVSIDDYEERREIKARL--PTDMHWEE 181 >Z48178-3|CAC42246.1| 1553|Caenorhabditis elegans Hypothetical protein C05C10.2b protein. Length = 1553 Score = 27.5 bits (58), Expect = 8.7 Identities = 16/64 (25%), Positives = 29/64 (45%) Frame = +3 Query: 78 LVFNKHVTLVFRTIIL*YNINPHLQPLKLRMSSLKKILLEPRACLVTAKRFRGKINIQRQ 257 ++F H+ ++ + ++ PH Q L + K P +VTA +G +NI R Sbjct: 1147 MLFGDHIAQIYDKLSADFSRAPHAQTLVEAFFMIYK----PDLVMVTADSAKGLLNILRD 1202 Query: 258 GCLI 269 C + Sbjct: 1203 VCAV 1206 >Z48178-2|CAA88201.1| 1551|Caenorhabditis elegans Hypothetical protein C05C10.2a protein. Length = 1551 Score = 27.5 bits (58), Expect = 8.7 Identities = 16/64 (25%), Positives = 29/64 (45%) Frame = +3 Query: 78 LVFNKHVTLVFRTIIL*YNINPHLQPLKLRMSSLKKILLEPRACLVTAKRFRGKINIQRQ 257 ++F H+ ++ + ++ PH Q L + K P +VTA +G +NI R Sbjct: 1147 MLFGDHIAQIYDKLSADFSRAPHAQTLVEAFFMIYK----PDLVMVTADSAKGLLNILRD 1202 Query: 258 GCLI 269 C + Sbjct: 1203 VCAV 1206 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,294,140 Number of Sequences: 27780 Number of extensions: 335034 Number of successful extensions: 949 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 924 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 949 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1444744186 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -