BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00993 (652 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g60890.1 68416.m06812 hypothetical protein 30 1.2 At5g62240.1 68418.m07815 expressed protein various predicted pro... 29 2.7 At1g22360.1 68414.m02797 UDP-glucoronosyl/UDP-glucosyl transfera... 29 2.7 At3g42530.1 68416.m04410 Ulp1 protease family similar to At5g281... 29 3.5 At1g28110.2 68414.m03444 serine carboxypeptidase S10 family prot... 29 3.5 At1g28110.1 68414.m03443 serine carboxypeptidase S10 family prot... 29 3.5 At4g03970.1 68417.m00561 Ulp1 protease family protein contains P... 28 6.2 At1g70340.1 68414.m08092 expressed protein 28 6.2 At5g53520.1 68418.m06651 oligopeptide transporter OPT family pro... 27 8.2 At5g43520.1 68418.m05321 DC1 domain-containing protein contains ... 27 8.2 At5g40590.1 68418.m04926 DC1 domain-containing protein predicted... 27 8.2 At2g10350.1 68415.m01087 Ulp1 protease family protein similar to... 27 8.2 At1g65930.1 68414.m07481 isocitrate dehydrogenase, putative / NA... 27 8.2 At1g44880.1 68414.m05142 Ulp1 protease family protein similar to... 27 8.2 >At3g60890.1 68416.m06812 hypothetical protein Length = 105 Score = 30.3 bits (65), Expect = 1.2 Identities = 18/53 (33%), Positives = 25/53 (47%), Gaps = 2/53 (3%) Frame = +2 Query: 179 KKNSFRASSMFSHSKEVSRENKY--SKARLPHFERQLLLDLSKPKYGPPKYTL 331 K+ R +F ++ + REN+ KA L H E L L PKY P +L Sbjct: 51 KEMEMRNLKLFVENQSIIRENEALKKKALLLHHENNALFALLHPKYSPVSTSL 103 >At5g62240.1 68418.m07815 expressed protein various predicted proteins, Arabidopsis thaliana; expression supported by MPSS Length = 366 Score = 29.1 bits (62), Expect = 2.7 Identities = 24/85 (28%), Positives = 41/85 (48%), Gaps = 4/85 (4%) Frame = +3 Query: 84 FNKHVTLVFRTIIL*YNINPHLQPLKL-RMSSLKKILLEPRACLVTAKR---FRGKINIQ 251 F ++V V + + + N Q K+ +SS K+ + L TA+R R K+N Q Sbjct: 164 FGENVAPVLVSKLQNQDTNRQKQEAKVAHVSSRAKLTVPKEPNLRTAERSERHRSKVNTQ 223 Query: 252 RQGCLISNGSYYLIYQNLNMVRPST 326 R+ SN ++ +N+N+ ST Sbjct: 224 REQIATSNSKRHIRNKNINLEPVST 248 >At1g22360.1 68414.m02797 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 481 Score = 29.1 bits (62), Expect = 2.7 Identities = 16/59 (27%), Positives = 29/59 (49%), Gaps = 4/59 (6%) Frame = +2 Query: 314 PPKYTLPDFLLCDRGEKKNKTEIDNPFERILARE--CLEWVNTS--KMIVFLHVNPITM 478 PP Y++ L ++ E +EI + E CL+W+NT +V+++ IT+ Sbjct: 248 PPVYSIGPLHLLEKQESGEYSEIGRTGSNLWREETECLDWLNTKARNSVVYVNFGSITV 306 >At3g42530.1 68416.m04410 Ulp1 protease family similar to At5g28170, At1g35110, At1g44880, At4g19320, At5g36020, At4g03970, At3g43010, At2g10350; contains Pfam profile PF02902: Ulp1 protease family, C-terminal catalytic domain Length = 889 Score = 28.7 bits (61), Expect = 3.5 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = -1 Query: 235 PRNLFAVTKHARGSKRIFFNDDILSF 158 P LFA+ ++ RG I+ DILSF Sbjct: 18 PNRLFAIDQYPRGRLNIYSRPDILSF 43 >At1g28110.2 68414.m03444 serine carboxypeptidase S10 family protein similar to H.vulgare gene encoding serine carboxypeptidase II, CP-MII GI:1731989 Length = 461 Score = 28.7 bits (61), Expect = 3.5 Identities = 14/39 (35%), Positives = 22/39 (56%) Frame = +1 Query: 514 NKMYLRTYGKKIVSLATKGTRYEVVNELFTSHXNIIFGQ 630 N +YL T S +T+ + YE VN+ T+ N++F Q Sbjct: 119 NMLYLETPVGVGFSYSTQSSHYEGVNDKITARDNLVFLQ 157 >At1g28110.1 68414.m03443 serine carboxypeptidase S10 family protein similar to H.vulgare gene encoding serine carboxypeptidase II, CP-MII GI:1731989 Length = 461 Score = 28.7 bits (61), Expect = 3.5 Identities = 14/39 (35%), Positives = 22/39 (56%) Frame = +1 Query: 514 NKMYLRTYGKKIVSLATKGTRYEVVNELFTSHXNIIFGQ 630 N +YL T S +T+ + YE VN+ T+ N++F Q Sbjct: 119 NMLYLETPVGVGFSYSTQSSHYEGVNDKITARDNLVFLQ 157 >At4g03970.1 68417.m00561 Ulp1 protease family protein contains Pfam profile PF02902: Ulp1 protease family, C-terminal catalytic domain; similar to At5g28170, At1g35110, At1g44880, At3g42530, At4g19320, At5g36020, At3g43010, At2g10350 Length = 1043 Score = 27.9 bits (59), Expect = 6.2 Identities = 12/26 (46%), Positives = 15/26 (57%) Frame = -1 Query: 235 PRNLFAVTKHARGSKRIFFNDDILSF 158 P LFA ++ RG I+ DILSF Sbjct: 18 PNRLFATDQYPRGKLNIYSRPDILSF 43 >At1g70340.1 68414.m08092 expressed protein Length = 510 Score = 27.9 bits (59), Expect = 6.2 Identities = 15/36 (41%), Positives = 23/36 (63%), Gaps = 1/36 (2%) Frame = +2 Query: 344 LCDRGEKKNKTEIDNPFERIL-ARECLEWVNTSKMI 448 +CDR KKN + +PF+ L A+E + ++TSK I Sbjct: 223 VCDRQAKKNNASLFSPFKSSLEAQEDVVPLSTSKKI 258 >At5g53520.1 68418.m06651 oligopeptide transporter OPT family protein similar to SP|P40900 Sexual differentiation process protein isp4 {Schizosaccharomyces pombe}, oligopeptide transporter Opt1p [Candida albicans] GI:2367386; contains Pfam profile PF03169: OPT oligopeptide transporter protein Length = 733 Score = 27.5 bits (58), Expect = 8.2 Identities = 11/31 (35%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = +1 Query: 4 RYVMGNWKKIEINS-IIYSNFKNIPVWYLIS 93 R G KK++I++ I+ N+K +P+W+ +S Sbjct: 388 RGAFGKNKKMDIHTKIMKRNYKEVPLWWFLS 418 >At5g43520.1 68418.m05321 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 250 Score = 27.5 bits (58), Expect = 8.2 Identities = 14/41 (34%), Positives = 19/41 (46%) Frame = +3 Query: 465 TP*QWRTRRQFTLP**E*NVFKNLWKKNCKPCDKRNTLRSC 587 TP + R FT + + ++LW CK CD L SC Sbjct: 144 TPCKGREDTYFTCSACDETISEDLWMYYCKDCDYGTHLHSC 184 >At5g40590.1 68418.m04926 DC1 domain-containing protein predicted protein, Arabidopsis thaliana Length = 234 Score = 27.5 bits (58), Expect = 8.2 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +3 Query: 531 NLWKKNCKPCDKRNTLRSCQ 590 NLW CK CD L SC+ Sbjct: 154 NLWSYYCKECDYATHLHSCK 173 >At2g10350.1 68415.m01087 Ulp1 protease family protein similar to At5g28170, At1g35110, At1g44880, At3g42530, At4g19320, At5g36020, At4g03970, At3g43010 ; contains Pfam profile PF02902: Ulp1 protease family, C-terminal catalytic domain Length = 1110 Score = 27.5 bits (58), Expect = 8.2 Identities = 12/26 (46%), Positives = 15/26 (57%) Frame = -1 Query: 235 PRNLFAVTKHARGSKRIFFNDDILSF 158 P LFA ++ RG I+ DILSF Sbjct: 18 PNRLFATDQYPRGRLNIYSRPDILSF 43 >At1g65930.1 68414.m07481 isocitrate dehydrogenase, putative / NADP+ isocitrate dehydrogenase, putative strong similarity to isocitrate dehydrogenase SP|Q40345 from [Medicago sativa] Length = 410 Score = 27.5 bits (58), Expect = 8.2 Identities = 15/45 (33%), Positives = 25/45 (55%) Frame = +2 Query: 161 TENVIIKKNSFRASSMFSHSKEVSRENKYSKARLPHFERQLLLDL 295 T+N I+KK R +F E S ++KY A + +E +L+ D+ Sbjct: 211 TKNTILKKYDGRFKDIFQEVYEASWKSKYDAAGI-WYEHRLIDDM 254 >At1g44880.1 68414.m05142 Ulp1 protease family protein similar to At5g28170, At1g35110, At3g42530, At4g19320, At5g36020, At4g03970, At3g43010, At2g10350; contains Pfam profile PF02902: Ulp1 protease family, C-terminal catalytic domain Length = 1038 Score = 27.5 bits (58), Expect = 8.2 Identities = 12/26 (46%), Positives = 15/26 (57%) Frame = -1 Query: 235 PRNLFAVTKHARGSKRIFFNDDILSF 158 P LFA ++ RG I+ DILSF Sbjct: 18 PNRLFATDQYPRGRLNIYSRPDILSF 43 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,114,621 Number of Sequences: 28952 Number of extensions: 298717 Number of successful extensions: 851 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 840 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 851 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1354097952 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -