BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00991 (681 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ201783-1|ABB05503.1| 381|Apis mellifera capa receptor-like GP... 27 0.13 DQ151547-1|ABA39280.1| 405|Apis mellifera tyramine receptor pro... 23 2.7 AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. 23 2.7 >DQ201783-1|ABB05503.1| 381|Apis mellifera capa receptor-like GPCR protein. Length = 381 Score = 27.5 bits (58), Expect = 0.13 Identities = 15/51 (29%), Positives = 28/51 (54%), Gaps = 3/51 (5%) Frame = +1 Query: 151 YVYAKQAGILTYDSQWIPITLIGIYMFSLTVGVSSYHL---RYQGSFSRWI 294 YVYA+++ ++W+ I +Y FS T+ Y+L +Y+ +F + I Sbjct: 293 YVYAQESDYYPDLNEWLYILSGCLYYFSTTINPILYNLMSIKYRNAFKQTI 343 >DQ151547-1|ABA39280.1| 405|Apis mellifera tyramine receptor protein. Length = 405 Score = 23.0 bits (47), Expect = 2.7 Identities = 9/23 (39%), Positives = 11/23 (47%) Frame = -3 Query: 103 IEGFFSLTFS*GIWRLNCISVFR 35 I F+S F WRL C F+ Sbjct: 358 IYAFYSADFRLAFWRLTCRKCFK 380 >AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. Length = 554 Score = 23.0 bits (47), Expect = 2.7 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = -2 Query: 449 PNYHHANRHNTSVQEVRERQP 387 P +HH + S+Q + RQP Sbjct: 349 PPHHHHHHQTQSLQHLHYRQP 369 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 198,145 Number of Sequences: 438 Number of extensions: 4478 Number of successful extensions: 35 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 35 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 35 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20708550 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -