BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00990 (642 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC1281.07c |||glutathione S-transferase Gst3|Schizosaccharomyc... 26 4.0 SPAC2G11.02 |urb2||ribosome biogenesis protein Urb2 |Schizosacch... 26 5.3 >SPCC1281.07c |||glutathione S-transferase Gst3|Schizosaccharomyces pombe|chr 3|||Manual Length = 313 Score = 26.2 bits (55), Expect = 4.0 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -2 Query: 527 IYKNPYLENLIFKEKDNY 474 +Y +PYL NL F+ NY Sbjct: 95 LYNSPYLRNLYFRADPNY 112 >SPAC2G11.02 |urb2||ribosome biogenesis protein Urb2 |Schizosaccharomyces pombe|chr 1|||Manual Length = 1318 Score = 25.8 bits (54), Expect = 5.3 Identities = 18/72 (25%), Positives = 32/72 (44%) Frame = +2 Query: 194 LTETLRSP*HRETYA*LMRRLFVRLVHF*FQNETIKRTNAPVRSVVYVILYVPCAILKFY 373 L + P H T R L + ++H ++ + +R ++Y ++ PC+ FY Sbjct: 752 LKSLIHIPIHSITKNQRTRLLNLLIIHEKLLSDKDNSAHISLRKIIYTLMKTPCS-SGFY 810 Query: 374 SLKRIIIFHMVF 409 +III M F Sbjct: 811 RDPKIIIDLMQF 822 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,392,687 Number of Sequences: 5004 Number of extensions: 44935 Number of successful extensions: 85 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 84 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 85 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 287744314 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -